PDB entry 3nba

View 3nba on RCSB PDB site
Description: Phosphopantetheine Adenylyltranferase from Mycobacterium tuberculosis in complex with adenosine-5'-[(alpha,beta)-methyleno]triphosphate (AMPCPP)
Class: transferase
Keywords: PPAT, AMPCPP, phosphopantetheine adenylyltransferase, tuberculosis, TRANSFERASE
Deposited on 2010-06-03, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: 0.202
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: coaD, kdtB, MT3043, MTCY349.22, Rv2965c, u0002e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nbaa_
  • Chain 'B':
    Compound: phosphopantetheine adenylyltransferase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: coaD, kdtB, MT3043, MTCY349.22, Rv2965c, u0002e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nbab_
  • Chain 'C':
    Compound: phosphopantetheine adenylyltransferase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: coaD, kdtB, MT3043, MTCY349.22, Rv2965c, u0002e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nbac_
  • Chain 'D':
    Compound: phosphopantetheine adenylyltransferase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: coaD, kdtB, MT3043, MTCY349.22, Rv2965c, u0002e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nbad_
  • Heterogens: APC, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nbaA (A:)
    mgsshhhhhhssglvprgshmtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpa
    ktgmfdlderiamvkestthlpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelq
    maqmnkhiagvdtffvataprysfvssslakevamlggdvsellpepvnrrlrdrln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nbaA (A:)
    mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
    lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
    rysfvssslakevamlggdvsellpepvnrrlrdrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nbaB (B:)
    mgsshhhhhhssglvprgshmtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpa
    ktgmfdlderiamvkestthlpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelq
    maqmnkhiagvdtffvataprysfvssslakevamlggdvsellpepvnrrlrdrln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nbaB (B:)
    mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
    lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
    rysfvssslakevamlggdvsellpepvnrrlrdrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nbaC (C:)
    mgsshhhhhhssglvprgshmtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpa
    ktgmfdlderiamvkestthlpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelq
    maqmnkhiagvdtffvataprysfvssslakevamlggdvsellpepvnrrlrdrln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nbaC (C:)
    mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
    lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
    rysfvssslakevamlggdvsellpepvnrrlrdrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nbaD (D:)
    mgsshhhhhhssglvprgshmtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpa
    ktgmfdlderiamvkestthlpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelq
    maqmnkhiagvdtffvataprysfvssslakevamlggdvsellpepvnrrlrdrln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nbaD (D:)
    mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
    lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
    rysfvssslakevamlggdvsellpepvnrrlrdrl