PDB entry 3nb9

View 3nb9 on RCSB PDB site
Description: Crystal structure of radical H88Q Synechocystis sp. PCYA
Class: oxidoreductase
Keywords: alpha-beta-alpha sandwich, radical chemistry, oxidoreductase
Deposited on 2010-06-03, released 2010-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phycocyanobilin:ferredoxin oxidoreductase
    Species: Synechocystis sp. [TaxId:1148]
    Gene: pcyA, slr0116
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q55891
      • engineered mutation (87)
    Domains in SCOPe 2.07: d3nb9a_
  • Heterogens: EDO, BLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nb9A (A:)
    mavtdlsltnsslmptlnpmiqqlalaiaaswqslplkpyqlpedlgyvegrlegeklvi
    enrcyqtpqfrkmhlelakvgkgldilqcvmfpeplyglplfgcdivagpggvsaaiadl
    sptqsdrqlpaayqkslaelgqpefeqqrelppwgeifseyclfirpsnvteeerfvqrv
    vdflqihchqsivaeplseaqtlehrqgqihycqqqqkndktrrvlekafgeawaeryms
    qvlfdviq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nb9A (A:)
    lsltnsslmptlnpmiqqlalaiaaswqslplkpyqlpedlgyvegrlegeklvienrcy
    qtpqfrkmhlelakvgkgldilqcvmfpeplyglplfgcdivagpggvsaaiadlsptqs
    drqlpaayqkslaelgqpefeqqrelppwgeifseyclfirpsnvteeerfvqrvvdflq
    ihchqsivaeplseaqtlehrqgqihycqqqqkndktrrvlekafgeawaerymsqvlfd
    vi