PDB entry 3nb7

View 3nb7 on RCSB PDB site
Description: Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin
Class: Transferase
Keywords: Glycosyltransferases, Peptidoglycan Glycosyltransferase, Polysaccharides, cell wall, antibiotics, moenomycin, Transferase
Deposited on 2010-06-02, released 2011-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.233
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin-binding protein 1a
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: aq_624, mrcA, ponA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nb7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nb7A (A:)
    gpgyqdpkgrlygtigiqkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraai
    vnyragrivqggstitqqlaknlfltrertlerkikeallaikiertfdkkkimelylnq
    iylgsgaygveaaaqvyfgkhvwelsldeaallaalpkapakynpfyhperalqrrnlvl
    krmleegyitpeqyeeavnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nb7A (A:)
    giqkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraaivqggstitqqlaknl
    fltrertlerkikeallaikiertfdkkkimelylnqiylgsgaygveaaaqvyfgkhvw
    elsldeaallaalpkapakynpfyhperalqrrnlvlkrmleegyitpeqyeeavnk