PDB entry 3nb3

View 3nb3 on RCSB PDB site
Description: the host outer membrane proteins ompa and ompc are packed at specific sites in the shigella phage sf6 virion as structural components
Deposited on 2010-06-02, released 2011-02-16
The last revision was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: EM
Resolution: 19 Å
R-factor: N/A
AEROSPACI score: -0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: outer membrane protein a
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A910
      • see remark 999 (54)
      • see remark 999 (127)
  • Chain 'B':
    Compound: outer membrane protein a
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A910
      • see remark 999 (54)
      • see remark 999 (127)
  • Chain 'C':
    Compound: outer membrane protein a
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A910
      • see remark 999 (54)
      • see remark 999 (127)
  • Chain 'D':
    Compound: Outer membrane protein C
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nb3A (A:)
    mkktaiaiavalagfatvaqaapkdntwytgaklgwsqyhdtgfinnngpthenklgaga
    fggyqvnpyvgfemgydwlgrmpykgsvengaykaqgvqltaklgypitddldiytrlgg
    mvwradtysnvygknhdtgvspvfaggveyaitpeiatrleyqwtnnigdahtigtrpdn
    gmlslgvsyrfgqgeaapvvapapapapevqtkhftlksdvlfnfnkatlkpegqaaldq
    lysqlsnldpkdgsvvvlgytdrigsdaynqglserraqsvvdyliskgipadkisargm
    gesnpvtgntcdnvkqraalidclapdrrveievkgikdvvtqpqa
    

    Sequence, based on observed residues (ATOM records):
    >3nb3A (A:)
    apkdntwytgaklgwsqhenklgagafggyqvnpyvgfemgydwlgrmpyaykaqgvqlt
    aklgypitddldiytrlggmvwradtysnvygknhdtgvspvfaggveyaitpeiatrle
    yqwtngmlslgvsyrfg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nb3B (B:)
    mkktaiaiavalagfatvaqaapkdntwytgaklgwsqyhdtgfinnngpthenklgaga
    fggyqvnpyvgfemgydwlgrmpykgsvengaykaqgvqltaklgypitddldiytrlgg
    mvwradtysnvygknhdtgvspvfaggveyaitpeiatrleyqwtnnigdahtigtrpdn
    gmlslgvsyrfgqgeaapvvapapapapevqtkhftlksdvlfnfnkatlkpegqaaldq
    lysqlsnldpkdgsvvvlgytdrigsdaynqglserraqsvvdyliskgipadkisargm
    gesnpvtgntcdnvkqraalidclapdrrveievkgikdvvtqpqa
    

    Sequence, based on observed residues (ATOM records):
    >3nb3B (B:)
    apkdntwytgaklgwsqhenklgagafggyqvnpyvgfemgydwlgrmpyaykaqgvqlt
    aklgypitddldiytrlggmvwradtysnvygknhdtgvspvfaggveyaitpeiatrle
    yqwtngmlslgvsyrfg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nb3C (C:)
    mkktaiaiavalagfatvaqaapkdntwytgaklgwsqyhdtgfinnngpthenklgaga
    fggyqvnpyvgfemgydwlgrmpykgsvengaykaqgvqltaklgypitddldiytrlgg
    mvwradtysnvygknhdtgvspvfaggveyaitpeiatrleyqwtnnigdahtigtrpdn
    gmlslgvsyrfgqgeaapvvapapapapevqtkhftlksdvlfnfnkatlkpegqaaldq
    lysqlsnldpkdgsvvvlgytdrigsdaynqglserraqsvvdyliskgipadkisargm
    gesnpvtgntcdnvkqraalidclapdrrveievkgikdvvtqpqa
    

    Sequence, based on observed residues (ATOM records):
    >3nb3C (C:)
    apkdntwytgaklgwsqhenklgagafggyqvnpyvgfemgydwlgrmpyaykaqgvqlt
    aklgypitddldiytrlggmvwradtysnvygknhdtgvspvfaggveyaitpeiatrle
    yqwtngmlslgvsyrfg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >3nb3D (D:)
    aevynkdgnkldlygkvdglhyfsdnkdvdgdqtymrlgfkgetqvtdqltgygqweyqi
    qgnsaenennswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtygsdnf
    mqqrgngfatyrntdffglvdglnfavqyqgkngnpsgegftsgvtnngrdalrqngdgv
    ggsitydyegfgiggaissskrtdaqntaayigngdraetytgglkydanniylaaqytq
    tynatrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdv
    gatyyfnknmstyvdykinllddnqftrdagintdnivalglvyqf