PDB entry 3nb0

View 3nb0 on RCSB PDB site
Description: glucose-6-phosphate activated form of yeast glycogen synthase
Deposited on 2010-06-02, released 2010-10-06
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen [starch] synthase isoform 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GSY2, L8479.8, YLR258W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27472
      • see remark 999 (554)
      • engineered mutation (608)
      • engineered mutation (611)
  • Chain 'B':
    Compound: Glycogen [starch] synthase isoform 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GSY2, L8479.8, YLR258W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27472
      • see remark 999 (554)
      • engineered mutation (608)
      • engineered mutation (611)
  • Chain 'C':
    Compound: Glycogen [starch] synthase isoform 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GSY2, L8479.8, YLR258W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27472
      • see remark 999 (554)
      • engineered mutation (608)
      • engineered mutation (611)
  • Chain 'D':
    Compound: Glycogen [starch] synthase isoform 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GSY2, L8479.8, YLR258W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27472
      • see remark 999 (554)
      • engineered mutation (608)
      • engineered mutation (611)
  • Heterogens: G6P, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nb0A (A:)
    mgsshhhhhhssglvprgshmsrdlqnhllfetatevanrvggiysvlkskapitvaqyk
    dhyhligplnkatyqnevdildwkkpeafsdemrpvqhalqtmesrgvhfvygrwliega
    pkvilfdldsvrgysnewkgdlwslvgipspendfetndaillgytvawflgevahldsq
    haivahfhewlagvalplcrkrridvvtiftthatllgrylcasgsfdfynclesvdvdh
    eagrfgiyhrycieraaahsadvfttvsqitafeaehllkrkpdgilpnglnvikfqafh
    efqnlhalkkekindfvrghfhgcfdfdldntlyffiagryeyknkgadmfiealarlny
    rlkvsgskktvvafivmpaknnsftvealkgqaevralentvhevttsigkrifdhairy
    phnglttelptdlgellkssdkvmlkrrilalrrpegqlppivthnmvddandlilnkir
    qvqlfnspsdrvkmifhpeflnannpilgldydefvrgchlgvfpsyyepwgytpaectv
    mgvpsittnvsgfgsymedlietnqakdygiyivdrrfkapdesveqlvdymeefvkktr
    rqrinqrnatealsdlldwkrmgleyvkarqlalrrgypdqfrelvgeelndsnmdalag
    gkklkvarplsvpgsprdlrsnstvymtpgdlgtlqevnnaddyfslgvnpaadddddgp
    yadds
    

    Sequence, based on observed residues (ATOM records):
    >3nb0A (A:)
    srdlqnhllfetatevanrvggiysvlkskapitvaqykdhyhligplnkatyqnevdil
    dwkkpeafsdemrpvqhalqtmesrgvhfvygrwliegapkvilfdldsvrgysnewkgd
    lwslvgipspendfetndaillgytvawflgevahldsqhaivahfhewlagvalplcrk
    rridvvtiftthatllgrylcasgsfdfynclesvdvdheagrfgiyhrycieraaahsa
    dvfttvsqitafeaehllkrkpdgilpnglnvikfqafhefqnlhalkkekindfvrghf
    hgcfdfdldntlyffiagryeyknkgadmfiealarlnyrlkvsgskktvvafivmpakn
    nsftvealkgqaevralentvhevttsigkrifdhairyphnglttelptdlgellkssd
    kvmlkrrilalrrpegqlppivthnmvddandlilnkirqvqlfnspsdrvkmifhpefl
    nannpilgldydefvrgchlgvfpsyyepwgytpaectvmgvpsittnvsgfgsymedli
    etnqakdygiyivdrrfkapdesveqlvdymeefvkktrrqrinqrnatealsdlldwkr
    mgleyvkarqlalrrgypdqfrelvgeelndsnmdala
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nb0B (B:)
    mgsshhhhhhssglvprgshmsrdlqnhllfetatevanrvggiysvlkskapitvaqyk
    dhyhligplnkatyqnevdildwkkpeafsdemrpvqhalqtmesrgvhfvygrwliega
    pkvilfdldsvrgysnewkgdlwslvgipspendfetndaillgytvawflgevahldsq
    haivahfhewlagvalplcrkrridvvtiftthatllgrylcasgsfdfynclesvdvdh
    eagrfgiyhrycieraaahsadvfttvsqitafeaehllkrkpdgilpnglnvikfqafh
    efqnlhalkkekindfvrghfhgcfdfdldntlyffiagryeyknkgadmfiealarlny
    rlkvsgskktvvafivmpaknnsftvealkgqaevralentvhevttsigkrifdhairy
    phnglttelptdlgellkssdkvmlkrrilalrrpegqlppivthnmvddandlilnkir
    qvqlfnspsdrvkmifhpeflnannpilgldydefvrgchlgvfpsyyepwgytpaectv
    mgvpsittnvsgfgsymedlietnqakdygiyivdrrfkapdesveqlvdymeefvkktr
    rqrinqrnatealsdlldwkrmgleyvkarqlalrrgypdqfrelvgeelndsnmdalag
    gkklkvarplsvpgsprdlrsnstvymtpgdlgtlqevnnaddyfslgvnpaadddddgp
    yadds
    

    Sequence, based on observed residues (ATOM records):
    >3nb0B (B:)
    srdlqnhllfetatevanrvggiysvlkskapitvaqykdhyhligplnkatyqnevdil
    dwkkpeafsdemrpvqhalqtmesrgvhfvygrwliegapkvilfdldsvrgysnewkgd
    lwslvgipspendfetndaillgytvawflgevahldsqhaivahfhewlagvalplcrk
    rridvvtiftthatllgrylcasgsfdfynclesvdvdheagrfgiyhrycieraaahsa
    dvfttvsqitafeaehllkrkpdgilpnglnvikfqafhefqnlhalkkekindfvrghf
    hgcfdfdldntlyffiagryeyknkgadmfiealarlnyrlkvsgskktvvafivmpakn
    nsftvealkgqaevralentvhevttsigkrifdhairyphnglttelptdlgellkssd
    kvmlkrrilalrrpegqlppivthnmvddandlilnkirqvqlfnspsdrvkmifhpefl
    nannpilgldydefvrgchlgvfpsyyepwgytpaectvmgvpsittnvsgfgsymedli
    etnqakdygiyivdrrfkapdesveqlvdymeefvkktrrqrinqrnatealsdlldwkr
    mgleyvkarqlalrrgypdqfrelvgeelndsnmdalaggkklkv
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nb0C (C:)
    mgsshhhhhhssglvprgshmsrdlqnhllfetatevanrvggiysvlkskapitvaqyk
    dhyhligplnkatyqnevdildwkkpeafsdemrpvqhalqtmesrgvhfvygrwliega
    pkvilfdldsvrgysnewkgdlwslvgipspendfetndaillgytvawflgevahldsq
    haivahfhewlagvalplcrkrridvvtiftthatllgrylcasgsfdfynclesvdvdh
    eagrfgiyhrycieraaahsadvfttvsqitafeaehllkrkpdgilpnglnvikfqafh
    efqnlhalkkekindfvrghfhgcfdfdldntlyffiagryeyknkgadmfiealarlny
    rlkvsgskktvvafivmpaknnsftvealkgqaevralentvhevttsigkrifdhairy
    phnglttelptdlgellkssdkvmlkrrilalrrpegqlppivthnmvddandlilnkir
    qvqlfnspsdrvkmifhpeflnannpilgldydefvrgchlgvfpsyyepwgytpaectv
    mgvpsittnvsgfgsymedlietnqakdygiyivdrrfkapdesveqlvdymeefvkktr
    rqrinqrnatealsdlldwkrmgleyvkarqlalrrgypdqfrelvgeelndsnmdalag
    gkklkvarplsvpgsprdlrsnstvymtpgdlgtlqevnnaddyfslgvnpaadddddgp
    yadds
    

    Sequence, based on observed residues (ATOM records):
    >3nb0C (C:)
    srdlqnhllfetatevanrvggiysvlkskapitvaqykdhyhligplnkatyqnevdil
    dwkkpeafsdemrpvqhalqtmesrgvhfvygrwliegapkvilfdldsvrgysnewkgd
    lwslvgipspendfetndaillgytvawflgevahldsqhaivahfhewlagvalplcrk
    rridvvtiftthatllgrylcasgsfdfynclesvdvdheagrfgiyhrycieraaahsa
    dvfttvsqitafeaehllkrkpdgilpnglnvikfqafhefqnlhalkkekindfvrghf
    hgcfdfdldntlyffiagryeyknkgadmfiealarlnyrlkvsgskktvvafivmpakn
    nsftvealkgqaevralentvhevttsigkrifdhairyphnglttelptdlgellkssd
    kvmlkrrilalrrpegqlppivthnmvddandlilnkirqvqlfnspsdrvkmifhpefl
    nannpilgldydefvrgchlgvfpsyyepwgytpaectvmgvpsittnvsgfgsymedli
    etnqakdygiyivdrrfkapdesveqlvdymeefvkktrrqrinqrnatealsdlldwkr
    mgleyvkarqlalrrgypdqfrelvgeelndsnmdalaggkklkva
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nb0D (D:)
    mgsshhhhhhssglvprgshmsrdlqnhllfetatevanrvggiysvlkskapitvaqyk
    dhyhligplnkatyqnevdildwkkpeafsdemrpvqhalqtmesrgvhfvygrwliega
    pkvilfdldsvrgysnewkgdlwslvgipspendfetndaillgytvawflgevahldsq
    haivahfhewlagvalplcrkrridvvtiftthatllgrylcasgsfdfynclesvdvdh
    eagrfgiyhrycieraaahsadvfttvsqitafeaehllkrkpdgilpnglnvikfqafh
    efqnlhalkkekindfvrghfhgcfdfdldntlyffiagryeyknkgadmfiealarlny
    rlkvsgskktvvafivmpaknnsftvealkgqaevralentvhevttsigkrifdhairy
    phnglttelptdlgellkssdkvmlkrrilalrrpegqlppivthnmvddandlilnkir
    qvqlfnspsdrvkmifhpeflnannpilgldydefvrgchlgvfpsyyepwgytpaectv
    mgvpsittnvsgfgsymedlietnqakdygiyivdrrfkapdesveqlvdymeefvkktr
    rqrinqrnatealsdlldwkrmgleyvkarqlalrrgypdqfrelvgeelndsnmdalag
    gkklkvarplsvpgsprdlrsnstvymtpgdlgtlqevnnaddyfslgvnpaadddddgp
    yadds
    

    Sequence, based on observed residues (ATOM records):
    >3nb0D (D:)
    srdlqnhllfetatevanrvggiysvlkskapitvaqykdhyhligplnkatyqnevdil
    dwkkpeafsdemrpvqhalqtmesrgvhfvygrwliegapkvilfdldsvrgysnewkgd
    lwslvgipspendfetndaillgytvawflgevahldsqhaivahfhewlagvalplcrk
    rridvvtiftthatllgrylcasgdfynclesvdvdheagrfgiyhrycieraaahsadv
    fttvsqitafeaehllkrkpdgilpnglnvikfqafhefqnlhalkkekindfvrghfhg
    cfdfdldntlyffiagryeyknkgadmfiealarlnyrlkvsgskktvvafivmpaknns
    ftvealkgqaevralentvhevttsigkrifdhairyphnglttelptdlgellkssdkv
    mlkrrilalrrpegqlppivthnmvddandlilnkirqvqlfnspsdrvkmifhpeflna
    nnpilgldydefvrgchlgvfpsyyepwgytpaectvmgvpsittnvsgfgsymedliet
    nqakdygiyivdrrfkapdesveqlvdymeefvkktrrqrinqrnatealsdlldwkrmg
    leyvkarqlalrrgypdqfrelvgeelndsnmdala