PDB entry 3nay

View 3nay on RCSB PDB site
Description: PDK1 in complex with inhibitor MP6
Class: transferase
Keywords: Kinase, Serine/threonine protein kinase, TRANSFERASE
Deposited on 2010-06-02, released 2010-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.211
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoinositide-dependent protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PDPK1, PDK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3naya_
  • Chain 'B':
    Compound: 3-phosphoinositide-dependent protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PDPK1, PDK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nayb_
  • Heterogens: MP6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nayA (A:)
    mhhhhhhenlyfqgqhaqpppqprkkrpedfkfgkilgegsfstvvlarelatsreyaik
    ilekrhiikenkvpyvtrerdvmsrldhpffvklyftfqddeklyfglsyakngellkyi
    rkigsfdetctrfytaeivsaleylhgkgiihrdlkpenillnedmhiqitdfgtakvls
    peskqaransfvgtaqyvspellteksackssdlwalgciiyqlvaglppfragneylif
    qkiikleydfpekffpkardlvekllvldatkrlgceemegygplkahpffesvtwenlh
    qqtppkltayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nayA (A:)
    kkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerdvms
    rldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsaley
    lhgkgiihrdlkpenillnedmhiqitdfgtakvlsnsfvgtaqyvspellteksackss
    dlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvldatk
    rlgceemegygplkahpffesvtwenlhqqtppkltayl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nayB (B:)
    mhhhhhhenlyfqgqhaqpppqprkkrpedfkfgkilgegsfstvvlarelatsreyaik
    ilekrhiikenkvpyvtrerdvmsrldhpffvklyftfqddeklyfglsyakngellkyi
    rkigsfdetctrfytaeivsaleylhgkgiihrdlkpenillnedmhiqitdfgtakvls
    peskqaransfvgtaqyvspellteksackssdlwalgciiyqlvaglppfragneylif
    qkiikleydfpekffpkardlvekllvldatkrlgceemegygplkahpffesvtwenlh
    qqtppkltayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nayB (B:)
    kkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerdvms
    rldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsaley
    lhgkgiihrdlkpenillnedmhiqitdfgtakvlsnsfvgtaqyvspellteksackss
    dlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvldatk
    rlgceemegygplkahpffesvtwenlhqqtppkltayl