PDB entry 3nax

View 3nax on RCSB PDB site
Description: PDK1 in complex with inhibitor MP7
Class: transferase
Keywords: Kinase, Serine/threonine protein kinase, TRANSFERASE
Deposited on 2010-06-02, released 2010-11-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.166
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoinositide-dependent protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3naxa_
  • Heterogens: MP7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3naxA (A:)
    mhhhhhhenlyfqgqhaqpppqprkkrpedfkfgkilgegsfstvvlarelatsreyaik
    ilekrhiikenkvpyvtrerdvmsrldhpffvklyftfqddeklyfglsyakngellkyi
    rkigsfdetctrfytaeivsaleylhgkgiihrdlkpenillnedmhiqitdfgtakvls
    peskqaransfvgtaqyvspellteksackssdlwalgciiyqlvaglppfragneylif
    qkiikleydfpekffpkardlvekllvldatkrlgceemegygplkahpffesvtwenlh
    qqtppkltayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3naxA (A:)
    kkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerdvms
    rldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsaley
    lhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaraqyvspellteksacks
    sdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvldat
    krlgceemegygplkahpffesvtwenlhqqtppklta