PDB entry 3naw

View 3naw on RCSB PDB site
Description: Crystal structure of E. coli O157:H7 effector protein NleL
Deposited on 2010-06-02, released 2010-10-27
The last revision was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.187
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Secreted effector protein
    Species: Escherichia coli [TaxId:83334]
    Gene: ECs1560
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Secreted effector protein
    Species: Escherichia coli [TaxId:83334]
    Gene: ECs1560
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, GOL, MES, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nawA (A:)
    sqgraclskaeltadliwlsanrtgeesaeelnysgcdlsglslvglnlssvnfsgavld
    dtdlrmsdlsqavlencsfknsilnecnfcyanlsnciiralfensnfsnsnlknasfkg
    ssyiqyppilneadltgaiiipgmvlsgailgdvkelfseksntinlggcyidlsdiqen
    ilsvldnytksnksilltmntsddkynhdkvraaeelikkisldelaafrpyvkmslads
    fsihpylnnaniqqwlepicddffdtimswfnnsimmymengsllqagmyferhpgamvs
    ynssfiqivmngsrrdgmqerfrelyevylknekvypvtqqsdfglcdgsgkpdwdddsd
    laynwvllssqddgmammcslshmvdmlspntstnwmsfflykdgevqntfgyslsnlfs
    esfpifsipyhkafsqnfvsgildilisdnelkerfiealnsnksdykmiaddqqrklac
    vwnpfldgwelnaqhvdmimgshvlkdmplrkqaeilfclggvfckysssdmfgteydsp
    eilrryanglieqayktdpqvfgsvyyyndildrlqgrnnvftctavltdmltehakesf
    peifslyypvawr
    

    Sequence, based on observed residues (ATOM records):
    >3nawA (A:)
    lskaeltadliwlsanrtgeesaeelnysgcdlsglslvglnlssvnfsgavlddtdlrm
    sdlsqavlencsfknsilnecnfcyanlsnciiralfensnfsnsnlknasfkgssyiqy
    ppilneadltgaiiipgmvlsgailgdvkelfseksntinlggcyidlsdiqenilsvld
    nytksnksilltmntsddkynhdkvraaeelikkisldelaafrpyvkmsladsfsihpy
    lnnaniqqwlepicddffdtimswfnnsimmymengsllqagmyferhpgamvsynssfi
    qivmngsrrdgmqerfrelyevylknekvypvtqqsdfglcdgsgkpdwdddsdlaynwv
    llssqddgmammcslshmvdmlspntstnwmsfflykdgevqntfgyslsnlfsesfpif
    sipyhkafsqnfvsgildilisdnelkerfiealnsnksdykmiaddqqrklacvwnpfl
    dgwelnaqhvdmimgshvlkdmplrkqaeilfclggvfckysssdmfgteydspeilrry
    anglieqayktdpqvfgsvyyyndildrlqgrnnvftctavltdmltehakesfpeifsl
    yypvawr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nawB (B:)
    sqgraclskaeltadliwlsanrtgeesaeelnysgcdlsglslvglnlssvnfsgavld
    dtdlrmsdlsqavlencsfknsilnecnfcyanlsnciiralfensnfsnsnlknasfkg
    ssyiqyppilneadltgaiiipgmvlsgailgdvkelfseksntinlggcyidlsdiqen
    ilsvldnytksnksilltmntsddkynhdkvraaeelikkisldelaafrpyvkmslads
    fsihpylnnaniqqwlepicddffdtimswfnnsimmymengsllqagmyferhpgamvs
    ynssfiqivmngsrrdgmqerfrelyevylknekvypvtqqsdfglcdgsgkpdwdddsd
    laynwvllssqddgmammcslshmvdmlspntstnwmsfflykdgevqntfgyslsnlfs
    esfpifsipyhkafsqnfvsgildilisdnelkerfiealnsnksdykmiaddqqrklac
    vwnpfldgwelnaqhvdmimgshvlkdmplrkqaeilfclggvfckysssdmfgteydsp
    eilrryanglieqayktdpqvfgsvyyyndildrlqgrnnvftctavltdmltehakesf
    peifslyypvawr
    

    Sequence, based on observed residues (ATOM records):
    >3nawB (B:)
    raclskaeltadliwlsanrtgeesaeelnysgcdlsglslvglnlssvnfsgavlddtd
    lrmsdlsqavlencsfknsilnecnfcyanlsnciiralfensnfsnsnlknasfkgssy
    iqyppilneadltgaiiipgmvlsgailgdvkelfseksntinlggcyidlsdiqenils
    vldnytksnksilltmntsddkynhdkvraaeelikkisldelaafrpyvkmsladsfsi
    hpylnnaniqqwlepicddffdtimswfnnsimmymengsllqagmyferhpgamvsyns
    sfiqivmngsrrdgmqerfrelyevylknekvypvtqqsdfglcdgsgkpdwdddsdlay
    nwvllssqddgmammcslshmvdmlspntstnwmsfflykdgevqntfgyslsnlfsesf
    pifsipyhkafsqnfvsgildilisdnelkerfiealnsnksdykmiaddqqrklacvwn
    pfldgwelnaqhvdmimgshvlkdmplrkqaeilfclggvfckysssdmfgteydspeil
    rryanglieqayktdpqvfgsvyyyndildrlqgrnnvftctavltdmltehakesfpei
    fslyypvawr