PDB entry 3nav

View 3nav on RCSB PDB site
Description: Crystal structure of an alpha subunit of tryptophan synthase from Vibrio cholerae O1 biovar El Tor str. N16961
Class: lyase
Keywords: Tryptophan synthase, alpha subunit, STRUCTURAL GENOMICS, CSGID, Center for Structural Genomics of Infectious Diseases, LYASE
Deposited on 2010-06-02, released 2010-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.182
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase alpha chain
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3LLL5 (3-270)
      • expression tag (2)
    Domains in SCOPe 2.07: d3nava1, d3nava2
  • Chain 'B':
    Compound: tryptophan synthase alpha chain
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3LLL5 (3-270)
      • expression tag (2)
    Domains in SCOPe 2.07: d3navb1, d3navb2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3navA (A:)
    snamnryqalfqrlsaaqqgafvpfvtigdpnpeqslaimqtlidagadalelgmpfsdp
    ladgptiqganlralaakttpdicfeliaqirarnpetpigllmyanlvyargiddfyqr
    cqkagvdsvliadvptnesqpfvaaaekfgiqpifiapptasdetlravaqlgkgytyll
    sragvtgaetkanmpvhallerlqqfdappallgfgisepaqvkqaieagaagaisgsav
    vkiiethldnpakqltelanftqamkkatki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3navA (A:)
    amnryqalfqrlsaaqqgafvpfvtigdpnpeqslaimqtlidagadalelgmpfsdpla
    dgptiqganlralaakttpdicfeliaqirarnpetpigllmyanlvyargiddfyqrcq
    kagvdsvliadvptnesqpfvaaaekfgiqpifiapptasdetlravaqlgkgytyllsr
    aanmpvhallerlqqfdappallgfgisepaqvkqaieagaagaisgsavvkiiethldn
    pakqltelanftqamkkatki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3navB (B:)
    snamnryqalfqrlsaaqqgafvpfvtigdpnpeqslaimqtlidagadalelgmpfsdp
    ladgptiqganlralaakttpdicfeliaqirarnpetpigllmyanlvyargiddfyqr
    cqkagvdsvliadvptnesqpfvaaaekfgiqpifiapptasdetlravaqlgkgytyll
    sragvtgaetkanmpvhallerlqqfdappallgfgisepaqvkqaieagaagaisgsav
    vkiiethldnpakqltelanftqamkkatki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3navB (B:)
    amnryqalfqrlsaaqqgafvpfvtigdpnpeqslaimqtlidagadalelgmpfsdpla
    dgptiqganlralaakttpdicfeliaqirarnpetpigllmyanlvyargiddfyqrcq
    kagvdsvliadvptnesqpfvaaaekfgiqpifiapptasdetlravaqlgkgytyllsr
    apvhallerlqqfdappallgfgisepaqvkqaieagaagaisgsavvkiiethldnpak
    qltelanftqamkkatki