PDB entry 3nau

View 3nau on RCSB PDB site
Description: Crystal structure of ZHX2 HD2 (zinc-fingers and homeoboxes protein 2, homeodomain 2)
Deposited on 2010-06-02, released 2010-07-07
The last revision was dated 2010-07-07, with a file datestamp of 2010-07-02.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.207
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc fingers and homeoboxes protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ZHX2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Zinc fingers and homeoboxes protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ZHX2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nauA (A:)
    mahhhhhhrkktkeqiahlkasflqsqfpddaevyrlievtglarseikkwfsdhryrcq
    rgivhi
    

    Sequence, based on observed residues (ATOM records):
    >3nauA (A:)
    ktkeqiahlkasflqsqfpddaevyrlievtglarseikkwfsdhryrcqrgivhi
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nauB (B:)
    mahhhhhhrkktkeqiahlkasflqsqfpddaevyrlievtglarseikkwfsdhryrcq
    rgivhi
    

    Sequence, based on observed residues (ATOM records):
    >3nauB (B:)
    ktkeqiahlkasflqsqfpddaevyrlievtglarseikkwfsdhryrcqrgivhi