PDB entry 3nat

View 3nat on RCSB PDB site
Description: Crystal Structure of Conserved Protein of Unknown Function EF_1977 from Enterococcus faecalis
Deposited on 2010-06-02, released 2010-07-28
The last revision was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: 0.206
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: EF_1977
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q833H6 (3-End)
      • expression tag (0-2)
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: EF_1977
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q833H6 (3-End)
      • expression tag (0-2)
  • Heterogens: ZN, CIT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3natA (A:)
    snamkkatmltyleeqlekhlgdyevgldwdrknhtievivrlyaenneqvaiddvdgtl
    seeefiefedgllfynpqksvvddeeylvtipyegkkglrkavldgfihylkvvldegqs
    dlldflsdetaevfelhwepadfeamikkvaetekeqwiaypsy
    

    Sequence, based on observed residues (ATOM records):
    >3natA (A:)
    snamkkatmltyleeqlekhlgdyevgldwdrknhtievivrlyaenneqvaiddvefie
    fedgllfynpqksvvddeeylvtipyegkkglrkavldgfihylkvvldegqsdlldfls
    detaevfelhwepadfeamikkvaetekeqwiayps
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3natB (B:)
    snamkkatmltyleeqlekhlgdyevgldwdrknhtievivrlyaenneqvaiddvdgtl
    seeefiefedgllfynpqksvvddeeylvtipyegkkglrkavldgfihylkvvldegqs
    dlldflsdetaevfelhwepadfeamikkvaetekeqwiaypsy
    

    Sequence, based on observed residues (ATOM records):
    >3natB (B:)
    snamkkatmltyleeqlekhlgdyevgldwdrknhtievivrlyefedgllfynpqksvv
    ddeeylvtipyegkkglrkavldgfihylkvvldegqsdlldflsdetaevfelhwepad
    feamikkvaetekeqwiayp