PDB entry 3nas

View 3nas on RCSB PDB site
Description: The crystal structure of beta-phosphoglucomutase from Bacillus subtilis
Class: isomerase
Keywords: PSI, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, ISOMERASE
Deposited on 2010-06-02, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.235
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-phosphoglucomutase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU34550, yvdM
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06995 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d3nasa1, d3nasa2
  • Chain 'B':
    Compound: beta-phosphoglucomutase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU34550, yvdM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nasb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nasA (A:)
    slkavifdldgvitdtaeyhflawkhiaeqidipfdrdmnerlkgisreeslesilifgg
    aetkytnaekqelmhrknrdyqmliskltpedllpgigrllcqlknenikiglasssrna
    pkilrrlaiiddfhaivdpttlakgkpdpdifltaaamldvspadcaaiedaeagisaik
    sagmfavgvgqgqpmlgadlvvrqtsdltlellheeweqyrireseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nasA (A:)
    lkavifdldgvitdtaeyhflawkhiaeqidipfdrdmnerlkgisreeslesilifgga
    etkytnaekqelmhrknrdyqmliskltpedllpgigrllcqlknenikiglasssrnap
    kilrrlaiiddfhaivdppdifltaaamldvspadcaaiedaeagisaiksagmfavgvg
    adlvvrqtsdltlellheeweqyrire
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nasB (B:)
    slkavifdldgvitdtaeyhflawkhiaeqidipfdrdmnerlkgisreeslesilifgg
    aetkytnaekqelmhrknrdyqmliskltpedllpgigrllcqlknenikiglasssrna
    pkilrrlaiiddfhaivdpttlakgkpdpdifltaaamldvspadcaaiedaeagisaik
    sagmfavgvgqgqpmlgadlvvrqtsdltlellheeweqyrireseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nasB (B:)
    avifdldgvitdtaeyhflawkhiaeqidipfdrdmnerlkeeslesilifggaetkytn
    aekqelmhrknrdyqmliskltpedllpgigrllcqlknenikiglasssrnapkilrrl
    aiiddfhaivdppdifltaaampadcaaiedaeagisaiksagmfavgvgqgqpmlgadl
    vvrqtsdltlellheeweqyrires