PDB entry 3naq

View 3naq on RCSB PDB site
Description: Apo-form of NAD-dependent formate dehydrogenase from higher-plant Arabidopsis thaliana
Deposited on 2010-06-02, released 2010-07-07
The last revision was dated 2010-07-07, with a file datestamp of 2010-07-02.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.169
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formate dehydrogenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g14780, FDH, FDH1, T9L3_80
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: formate dehydrogenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g14780, FDH, FDH1, T9L3_80
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3naqA (A:)
    fnassgdskkivgvfykaneyatknpnflgcvenalgirdwlesqghqyivtddkegpdc
    elekhipdlhvlistpfhpayvtaerikkaknlkllltagigsdhidlqaaaaagltvae
    vtgsnvvsvaedelmrililmrnfvpgynqvvkgewnvagiayraydlegktigtvgagr
    igklllqrlkpfgcnllyhdrlqmapeleketgakfvedlnemlpkcdvivinmpltekt
    rgmfnkeligklkkgvlivnnargaimerqavvdavesghiggysgdvwdpqpapkdhpw
    rympnqamtphtsgttidaqlryaagtkdmleryfkgedfptenyivkdgelapqyr
    

    Sequence, based on observed residues (ATOM records):
    >3naqA (A:)
    dskkivgvfykaneyatknpnflgcvenalgirdwlesqghqyivtddkegpdcelekhi
    pdlhvlistpfhpayvtaerikkaknlkllltagigsdhidlqaaaaagltvaevtgsnv
    vsvaedelmrililmrnfvpgynqvvkgewnvagiayraydlegktigtvgagrigklll
    qrlkpfgcnllyhdrlqmapeleketgakfvedlnemlpkcdvivinmpltektrgmfnk
    eligklkkgvlivnnargaimerqavvdavesghiggysgdvwdpqpapkdhpwrympnq
    amtphtsgttidaqlryaagtkdmleryfkgedfptenyivkdgelapqyr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3naqB (B:)
    fnassgdskkivgvfykaneyatknpnflgcvenalgirdwlesqghqyivtddkegpdc
    elekhipdlhvlistpfhpayvtaerikkaknlkllltagigsdhidlqaaaaagltvae
    vtgsnvvsvaedelmrililmrnfvpgynqvvkgewnvagiayraydlegktigtvgagr
    igklllqrlkpfgcnllyhdrlqmapeleketgakfvedlnemlpkcdvivinmpltekt
    rgmfnkeligklkkgvlivnnargaimerqavvdavesghiggysgdvwdpqpapkdhpw
    rympnqamtphtsgttidaqlryaagtkdmleryfkgedfptenyivkdgelapqyr
    

    Sequence, based on observed residues (ATOM records):
    >3naqB (B:)
    dskkivgvfykaneyatknpnflgcvenalgirdwlesqghqyivtddkegpdcelekhi
    pdlhvlistpfhpayvtaerikkaknlkllltagigsdhidlqaaaaagltvaevtgsnv
    vsvaedelmrililmrnfvpgynqvvkgewnvagiayraydlegktigtvgagrigklll
    qrlkpfgcnllyhdrlqmapeleketgakfvedlnemlpkcdvivinmpltektrgmfnk
    eligklkkgvlivnnargaimerqavvdavesghiggysgdvwdpqpapkdhpwrympnq
    amtphtsgttidaqlryaagtkdmleryfkgedfptenyivkdgelapqyr