PDB entry 3nap

View 3nap on RCSB PDB site
Description: Structure of Triatoma Virus (TrV)
Deposited on 2010-06-02, released 2010-07-28
The last revision was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.171
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein
    Species: Triatoma virus [TaxId:103442]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: capsid protein
    Species: Triatoma virus [TaxId:103442]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: capsid protein
    Species: Triatoma virus [TaxId:103442]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QEY5 (0-End)
      • conflict (53)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3napA (A:)
    vgfasagtrdirssyvegkfipqditgmsrnheldeqpsqecigerilsfselikrnswr
    yvsdeksliypayafdnpaamytaadklpvwtltprsgfptlltsigamyafyrggirlk
    ivpgvadqpkplvevalftmqdqgyiikandystdfcssniyenfvtkgiaevqtpyysr
    vntsvvsapvlynagnisplmpnvmykitsnssnillghsaaddfrfgfllgaplaisat
    alrdnftgssatvslptfsnfylsstsestt
    

    Sequence, based on observed residues (ATOM records):
    >3napA (A:)
    vgfasagtrdirssyvegkfipqditgmsrnheldeqpsqecigerilsfselikrnswr
    yvsdeksliypayafdnpaamytaadklpvwtltprsgfptlltsigamyafyrggirlk
    ivpgvadqpkplvevalftmqdqgyiikandystdfcssniyenfvtkgiaevqtpyysr
    vntsvvsapvlynagnisplmpnvmykitsnssnillghsaaddfrfgfllgaplaisat
    alrdnftgssatvslptfsnfyls
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3napB (B:)
    lavnnvnmkqmnvnssqdttfeqrsqekvqageinesiefrnqittfvhdnpiiteqlig
    dspqpsgdvrsvsdarthsiidflerpqfigsflwntsdienkeifslklpdalmspmir
    eklsgftsfsastvfhiqvnahpfqcgrlvlaavpvpdilplhrlnmlsfdvsnvitlph
    vqldisketevllkipyvspfvqydlvtkftpwaaflahvyaplntpsaaslqvnvfahf
    ediklgfptsaivaq
    

    Sequence, based on observed residues (ATOM records):
    >3napB (B:)
    kqmnvnssqdttfeqrsqekvqageinesiefrnqittfvhdnpiiteqligdspqpsgd
    vrsvsdarthsiidflerpqfigsflwntsdienkeifslklpdalmspmireklsgfts
    fsastvfhiqvnahpfqcgrlvlaavpvpdilplhrlnmlsfdvsnvitlphvqldiske
    tevllkipyvspfvqydlvtkftpwaaflahvyaplntpsaaslqvnvfahfediklgfp
    tsaivaq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3napC (C:)
    skplttipptivvqrpsqyfnnadgvdqglplslkygnevilktpfagtssdemaleyvl
    kipnyfsrfkysstslpkqvlwtspvhpqiirnhvtvvdapgqptllayatgffkywrgg
    lvytfrfvktnyhsgrvqitfhpfvgyddvmdsdgkivrdeyvyrvvvdlrdqteatlvv
    pftsltpykvcadvfnsanrpkynyeprdfkvydnttdqfftgtlcvsaltplvsssavv
    sstidvlvevkasddfevavpntplwlpvdslterpsldgvpiaq
    

    Sequence, based on observed residues (ATOM records):
    >3napC (C:)
    skplttipptivvqrpsqyfnnadgvdqglplslkygnevilktpfagtssdemaleyvl
    kipnyfsrfkysstslpkqvlwtspvhpqiirnhvtvvdapgqptllayatgffkywrgg
    lvytfrfvktnyhsgrvqitfhpfvgyddvmdsdgkivrdeyvyrvvvdlrdqteatlvv
    pftsltpykvcadvfnsanrpkynyeprdfkvydnttdqfftgtlcvsaltplvsssavv
    sstidvlvevkasddfevavpntplwlpvdslterp