PDB entry 3naj

View 3naj on RCSB PDB site
Description: Crystal structure of a protease-resistant mutant form of human galectin-8
Class: sugar binding protein
Keywords: Sugar binding protein
Deposited on 2010-06-02, released 2011-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-07-11, with a file datestamp of 2012-07-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.216
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS8
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00214 (0-154)
      • linker (155-156)
    • Uniprot O00214 (157-290)
    Domains in SCOPe 2.08: d3naja1, d3naja2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3najA (A:)
    mmlslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpra
    dvafhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavng
    khtllyghrigpekidtlgiygkvnihsigfsfsshmrlpfaarlntpmgpgrtvvvkge
    vnanaksfnvdllagkskdialhlnprlnikafvrnsflqeswgeeernitsfpfspgmy
    femiiycdvrefkvavngvhsleykhrfkelssidtleingdihllevrsw