PDB entry 3nag

View 3nag on RCSB PDB site
Description: Crystal structure of the phosphoribosylpyrophosphate (PRPP) synthetase from Thermoplasma Volcanium in complex with ADP
Class: transferase
Keywords: phosphoribosyl transferase, ADP binding, TRANSFERASE
Deposited on 2010-06-02, released 2011-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.178
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribose-phosphate pyrophosphokinase
    Species: Thermoplasma volcanium GSS1 [TaxId:273116]
    Gene: prs, TV0197, TVG0201915, TVN0197
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3naga1, d3naga2
  • Chain 'B':
    Compound: Ribose-phosphate pyrophosphokinase
    Species: Thermoplasma volcanium GSS1 [TaxId:273116]
    Gene: prs, TV0197, TVG0201915, TVN0197
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nagb1, d3nagb2
  • Heterogens: SO4, ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nagA (A:)
    mkiialrsslklaariaeelktepvmpderrfpdgelylrydedltghnifiignthsda
    evmemiltlsaiqdyrtksvniiapyygyarqhqrykngepissqilteiyssysnsiat
    vdihdektlsyskvkfsdlhandaivryyknvdvdyvvspddgglarvadisaklgkkhf
    fiekkriddrtvemkvpnvdvngkkllivddiistggtiakssgllrekgaskiyvsavh
    glfvngsenkilqnadeihvtdtveskfsdisvyqevcnyirdida
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nagA (A:)
    mkiialrsslklaariaeelktepvmpderrfpdgelylrydedltghnifiignthsda
    evmemiltlsaiqdyrtksvniiapyygyarqhqrykngepissqilteiyssysnsiat
    vdihdektlsyskvkfsdlhandaivryyknvdvdyvvspddgglarvadisaklgkkhf
    fiekkriddrtvemkvpnvdvngkkllivddiistggtiakssgllrekgaskiyvsavh
    glfvngsenkilqnadeihvtdtveskfsdisvyqevcnyirdi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nagB (B:)
    mkiialrsslklaariaeelktepvmpderrfpdgelylrydedltghnifiignthsda
    evmemiltlsaiqdyrtksvniiapyygyarqhqrykngepissqilteiyssysnsiat
    vdihdektlsyskvkfsdlhandaivryyknvdvdyvvspddgglarvadisaklgkkhf
    fiekkriddrtvemkvpnvdvngkkllivddiistggtiakssgllrekgaskiyvsavh
    glfvngsenkilqnadeihvtdtveskfsdisvyqevcnyirdida