PDB entry 3naf

View 3naf on RCSB PDB site
Description: structure of the intracellular gating ring from the human high- conductance ca2+ gated k+ channel (bk channel)
Deposited on 2010-06-01, released 2010-06-30
The last revision was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium-activated potassium channel subunit alpha-1,Calcium-activated potassium channel subunit alpha-1,Calcium-activated potassium channel subunit alpha-1
    Species: Homo sapiens [TaxId:9606]
    Gene: KCNMA1, KCNMA, SLO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12791 (Start-326)
    • PDB 3NAF (327-342)
    • Uniprot Q12791 (343-End)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nafA (A:)
    gampdefrmkqiedkleeilsklyhienelarikkllgerkkyggsysavsgrkhivvcg
    hitlesvsnflkdflhkdrddvnveivflhnispnlelealfkrhftqvefyqgsvlnph
    dlarvkiesadaclilankycadpdaedasnimrvisiknyhpkiriitqmlqyhnkahl
    lnipswnwkegddaiclaelklgfiaqsclaqglstmlanlfsmrsfikieedtwqkyyl
    egvsnemyteylssafvglsfptvcelcfvklkllmiaieyksanresrilinpgnhlki
    qegtlgffiasdakevkraffyckachxxxxxxxxxxxxxxxxspklmrhdpllipgndq
    idnmdsnvkkydstgmfhwcapkeiekviltrseaamtvlsghvvvcifgdvssaliglr
    nlvmplrasnfhyhelkhivfvgsieylkrewetlhnfpkvsilpgtplsradlravnin
    lcdmcvilsanqnniddtslqdkecilaslniksmqfddsigvlqansqgftppgmdrss
    pdnspvhgmlrqpsittgvnipiitelvndtnvqfldqdddddpdtelyltqpfacgtaf
    avsvldslmsatyfndniltlirtlvtggatpelealiaeenalrggystpqtlanrdrc
    rvaqlalldgpfadlgdggcygdlfckalktynmlcfgiyrlrdahlstpsqctkryvit
    nppyefelvptdlifclmqfdhnagqsraslshsshssqssskksssvhsipstanrqnr
    pksresrdkqkyvqeerl
    

    Sequence, based on observed residues (ATOM records):
    >3nafA (A:)
    kyggsysavsgrkhivvcghitlesvsnflkdflhkdrddvnveivflhnispnleleal
    fkrhftqvefyqgsvlnphdlarvkiesadaclilankycadpdaedasnimrvisikny
    hpkiriitqmlqyhnkahllnipswnwkegddaiclaelklgfiaqsclaqglstmlanl
    fsmrsfikieedtwqkyylegvsnemyteylssafvglsfptvcelcfvklkllmiaiey
    ksanresrilinpgnhlkiqegtlgffiasdakevkraffyckachxxxxxxxxxxxxxx
    xxspklmrhdkkydstgmfhwcapkeiekviltrseaamtvlsghvvvcifgdvssalig
    lrnlvmplrasnfhyhelkhivfvgsieylkrewetlhnfpkvsilpgtplsradlravn
    inlcdmcvilsanqnniddtslqdkecilaslniksmqfdtgvnipiitelvndtnvqfl
    dqdddddpdtelyltqpfacgtafavsvldslmsatyfndniltlirtlvtggatpelea
    liaeenalrggystpqtlanrdrcrvaqlalldgpfadlgdggcygdlfckalktynmlc
    fgiyrlrdahlstpsqctkryvitnppyefelvptdlifclmqfdhna