PDB entry 3nab

View 3nab on RCSB PDB site
Description: Crystal Structure of fab15 Mut6
Class: immune system
Keywords: antibody, antibody canonical structure, thermal stability, non-X-pro cis peptide bond, antibody engineering, IMMUNE SYSTEM
Deposited on 2010-06-01, released 2010-08-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.206
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: Fab15 Mut6 heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 3NAB (0-221)
• Chain 'L':
  Compound: Fab15 Mut6 light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 3NAB (0-213)
  Domains in SCOPe 2.06: d3nabl1, d3nabl2
• Heterogens: ZN, ACT, HOH

PDB Chain Sequences:

• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3nabL (L:)
  diqmtqspsslsasvgdrvtitcrasqsiglylawyqqkpgkapklliyaasslqsgvps
  rfsgsgsgtdftltisslqpedfatyycqqgntlsytfgqgtkveikrtvaapsvfifpp
  sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
  lskadyekhkvyacevthqglsspvtksfnrgec