PDB entry 3na9

View 3na9 on RCSB PDB site
Description: Crystal structure of Fab15
Class: immune system
Keywords: antibody, antibody canonical structure, thermal stability, non-X-pro cis peptide bond, antibody engineering, IMMUNE SYSTEM
Deposited on 2010-06-01, released 2010-08-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.169
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab15 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NA9 (0-224)
  • Chain 'L':
    Compound: Fab15 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NA9 (0-213)
    Domains in SCOPe 2.05: d3na9l1, d3na9l2
  • Heterogens: ZN, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3na9L (L:)
    diqmtqspsslsasvgdrvtitcrasqsiglylawyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqgntlsytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec