PDB entry 3na8

View 3na8 on RCSB PDB site
Description: Crystal Structure of a putative dihydrodipicolinate synthetase from Pseudomonas aeruginosa
Class: lyase
Keywords: lyase
Deposited on 2010-06-01, released 2011-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.237
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative dihydrodipicolinate synthetase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA0223
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3na8a_
  • Chain 'B':
    Compound: Putative dihydrodipicolinate synthetase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA0223
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3na8b_
  • Chain 'C':
    Compound: Putative dihydrodipicolinate synthetase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA0223
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3na8c_
  • Chain 'D':
    Compound: Putative dihydrodipicolinate synthetase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA0223
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3na8d_
  • Heterogens: MG, MLT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3na8A (A:)
    mgsshhhhhhssglvprgshmsasihgiigytitpfaadggldlpalgrsierlidggvh
    aiaplgstgegaylsdpewdevvdftlktvahrvptivsvsdlttaktvrraqfaeslga
    eavmvlpisywklneaevfqhyravgeaigvpvmlynnpgtsgidmsvelilrivrevdn
    vtmvkestgdiqrmhklrllgegrvpfyngcnplaleafvagakgwcsaapnliptlngq
    lyqavldgdlekaralfyrqlplldfilrrglpttikaglglsglevgaprlpvqaldte
    gcrylqglleelrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3na8A (A:)
    asihgiigytitpfaadggldlpalgrsierlidggvhaiaplgstgegaylsdpewdev
    vdftlktvahrvptivsvsdlttaktvrraqfaeslgaeavmvlpisywklneaevfqhy
    ravgeaigvpvmlynnpgtsgidmsvelilrivrevdnvtmvkestgdiqrmhklrllge
    grvpfyngcnplaleafvagakgwcsaapnliptlngqlyqavldgdlekaralfyrqlp
    lldfilrrglpttikaglglsglevgaprlpvqaldtegcrylqglleelr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3na8B (B:)
    mgsshhhhhhssglvprgshmsasihgiigytitpfaadggldlpalgrsierlidggvh
    aiaplgstgegaylsdpewdevvdftlktvahrvptivsvsdlttaktvrraqfaeslga
    eavmvlpisywklneaevfqhyravgeaigvpvmlynnpgtsgidmsvelilrivrevdn
    vtmvkestgdiqrmhklrllgegrvpfyngcnplaleafvagakgwcsaapnliptlngq
    lyqavldgdlekaralfyrqlplldfilrrglpttikaglglsglevgaprlpvqaldte
    gcrylqglleelrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3na8B (B:)
    asihgiigytitpfadggldlpalgrsierlidggvhaiaplgstgegaylsdpewdevv
    dftlktvahrvptivsvsdlttaktvrraqfaeslgaeavmvlpisywklneaevfqhyr
    avgeaigvpvmlynnpgtsgidmsvelilrivrevdnvtmvkestgdiqrmhklrllgeg
    rvpfyngcnplaleafvagakgwcsaapnliptlngqlyqavldgdlekaralfyrqlpl
    ldfilrrglpttikaglglsglevgaprlpvqaldtegcrylqglleelr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3na8C (C:)
    mgsshhhhhhssglvprgshmsasihgiigytitpfaadggldlpalgrsierlidggvh
    aiaplgstgegaylsdpewdevvdftlktvahrvptivsvsdlttaktvrraqfaeslga
    eavmvlpisywklneaevfqhyravgeaigvpvmlynnpgtsgidmsvelilrivrevdn
    vtmvkestgdiqrmhklrllgegrvpfyngcnplaleafvagakgwcsaapnliptlngq
    lyqavldgdlekaralfyrqlplldfilrrglpttikaglglsglevgaprlpvqaldte
    gcrylqglleelrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3na8C (C:)
    asihgiigytitpfaadggldlpalgrsierlidggvhaiaplgstgegaylsdpewdev
    vdftlktvahrvptivsvsdlttaktvrraqfaeslgaeavmvlpisywklneaevfqhy
    ravgeaigvpvmlynnpgtsgidmsvelilrivrevdnvtmvkestgdiqrmhklrllge
    grvpfyngcnplaleafvagakgwcsaapnliptlngqlyqavldgdlekaralfyrqlp
    lldfilrrglpttikaglglsglevgaprlpvqaldtegcrylqglleelr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3na8D (D:)
    mgsshhhhhhssglvprgshmsasihgiigytitpfaadggldlpalgrsierlidggvh
    aiaplgstgegaylsdpewdevvdftlktvahrvptivsvsdlttaktvrraqfaeslga
    eavmvlpisywklneaevfqhyravgeaigvpvmlynnpgtsgidmsvelilrivrevdn
    vtmvkestgdiqrmhklrllgegrvpfyngcnplaleafvagakgwcsaapnliptlngq
    lyqavldgdlekaralfyrqlplldfilrrglpttikaglglsglevgaprlpvqaldte
    gcrylqglleelrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3na8D (D:)
    sihgiigytitpfaadggldlpalgrsierlidggvhaiaplgstgegaylsdpewdevv
    dftlktvahrvptivsvsdlttaktvrraqfaeslgaeavmvlpisywklneaevfqhyr
    avgeaigvpvmlynnpgtsgidmsvelilrivrevdnvtmvkestgdiqrmhklrllgeg
    rvpfyngcnplaleafvagakgwcsaapnliptlngqlyqavldgdlekaralfyrqlpl
    ldfilrrglpttikaglglsglevgaprlpvqaldtegcrylqglleelr