PDB entry 3na7

View 3na7 on RCSB PDB site
Description: 2.2 Angstrom Structure of the HP0958 Protein from Helicobacter pylori CCUG 17874
Deposited on 2010-06-01, released 2010-09-22
The last revision was dated 2010-12-29, with a file datestamp of 2010-12-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.251
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hp0958
    Species: Helicobacter pylori [TaxId:102619]
    Gene: HP0958
    Database cross-references and differences (RAF-indexed):
    • PDB 3NA7 (3-End)
      • expression tag (0-2)
  • Heterogens: ZN, MG, EPE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3na7A (A:)
    lgsnthlkqlieishldkeidsleplirekrkdldkalndkeaknkailnleeeklalkl
    qvskneqtlqdtnakiasiqkkmseikserelrslnieediakersnqanreienlqnei
    krksekqedlkkemleleklaleleslvenevkniketqqiifkkkedlvektepkiysf
    yerirrwakntsivtikkqacggcfirlndkiytevltsgdmitcpycgrilyaegayes
    naqppkesqeesqelv
    

    Sequence, based on observed residues (ATOM records):
    >3na7A (A:)
    lgsnthlkqlieishldkeidsleplirekrkdldkalndkeaknkailnleeeklalkl
    qvskneqtlqdtnakiasiqkkmseikserelrslnieediakersnqanreienlqnei
    krksekqedlkkemleleklaleleslvenevkniketqqiifkkkedlvektepkiysf
    yerirrwakntsivtikkqacggcfirlndkiytevltsgdmitcpycgrilyaega