PDB entry 3na5

View 3na5 on RCSB PDB site
Description: Crystal structure of a bacterial phosphoglucomutase, an enzyme important in the virulence of several human pathogens.
Deposited on 2010-06-01, released 2011-02-16
The last revision was dated 2011-03-23, with a file datestamp of 2011-03-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglucomutase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Gene: pgm, STM0698
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: phosphoglucomutase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Gene: pgm, STM0698
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BTB, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3na5A (A:)
    mhhhhhhssgvdlgtenlyfqsnamaihnragqpaqqsdlinvaqltaqyyvlkpeagna
    ehavkfgtsghrgsagrhsfnephilaiaqaiaeerakngitgpcyvgkdthalsepafi
    svlevlaangvdvivqenngftptpavsnailvhnkkggpladgivitpshnppedggik
    ynppnggpadtnvtkvvedranallagglqgvkrisldaamasghvkavdlvqpfvegla
    divdmaaiqkagltlgvdplggsgieywkriaehyklnltlvndqvdqtfrfmhldkdga
    irmdcssecamagllalrdkfdlafandpdydrhgivtpaglmnpnhylavainylfqhr
    plwgkdvavgktlvssamidrvvndlgrklvevpvgfkwfvdglfdgsfgfggeesagas
    flrfdgtpwstdkdgiimcllaaeitavtgknpqehynelaarfgapsynrlqasatsaq
    kaalsklspemvsastlagdpitarltaapgngasigglkvmtdngwfaarpsgtedayk
    iycesflgeehrkqiekeaveivsevlkna
    

    Sequence, based on observed residues (ATOM records):
    >3na5A (A:)
    aihnragqpaqqsdlinvaqltaqyyvlkpeagnaehavkfgtsghrgsagrhsfnephi
    laiaqaiaeerakngitgpcyvgkdthalsepafisvlevlaangvdvivqenngftptp
    avsnailvhnkkggpladgivitpshnppedggikynppnggpadtnvtkvvedranall
    agglqgvkrisldaamasghvkavdlvqpfvegladivdmaaiqkagltlgvdplggsgi
    eywkriaehyklnltlvndqvdqtfrfmhldkdgairmdcssecamagllalrdkfdlaf
    andpdydrhgivtpaglmnpnhylavainylfqhrplwgkdvavgktlvssamidrvvnd
    lgrklvevpvgfkwfvdglfdgsfgfggeesagasflrfdgtpwstdkdgiimcllaaei
    tavtgknpqehynelaarfgapsynrlqasatsaqkaalsklspemvsastlagdpitar
    ltaapgngasigglkvmtdngwfaarpsgtedaykiycesflgeehrkqiekeaveivse
    vlkna
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3na5B (B:)
    mhhhhhhssgvdlgtenlyfqsnamaihnragqpaqqsdlinvaqltaqyyvlkpeagna
    ehavkfgtsghrgsagrhsfnephilaiaqaiaeerakngitgpcyvgkdthalsepafi
    svlevlaangvdvivqenngftptpavsnailvhnkkggpladgivitpshnppedggik
    ynppnggpadtnvtkvvedranallagglqgvkrisldaamasghvkavdlvqpfvegla
    divdmaaiqkagltlgvdplggsgieywkriaehyklnltlvndqvdqtfrfmhldkdga
    irmdcssecamagllalrdkfdlafandpdydrhgivtpaglmnpnhylavainylfqhr
    plwgkdvavgktlvssamidrvvndlgrklvevpvgfkwfvdglfdgsfgfggeesagas
    flrfdgtpwstdkdgiimcllaaeitavtgknpqehynelaarfgapsynrlqasatsaq
    kaalsklspemvsastlagdpitarltaapgngasigglkvmtdngwfaarpsgtedayk
    iycesflgeehrkqiekeaveivsevlkna
    

    Sequence, based on observed residues (ATOM records):
    >3na5B (B:)
    aihnragqpaqqsdlinvaqltaqyyvlkpeagnaehavkfgtsghrgsagrhsfnephi
    laiaqaiaeerakngitgpcyvgkdthalsepafisvlevlaangvdvivqenngftptp
    avsnailvhnkkggpladgivitpshnppedggikynppnggpadtnvtkvvedranall
    agglqgvkrisldaamasghvkavdlvqpfvegladivdmaaiqkagltlgvdplggsgi
    eywkriaehyklnltlvndqvdqtfrfmhldkdgairmdcssecamagllalrdkfdlaf
    andpdydrhgivtpaglmnpnhylavainylfqhrplwgkdvavgktlvssamidrvvnd
    lgrklvevpvgfkwfvdglfdgsfgfggeesagasflrfdgtpwstdkdgiimcllaaei
    tavtgknpqehynelaarfgapsynrlqasatsaqkaalsklspemvsastlagdpitar
    ltaapgngasigglkvmtdngwfaarpsgtedaykiycesflgeehrkqiekeaveivse
    vlkna