PDB entry 3na4

View 3na4 on RCSB PDB site
Description: D53P beta-2 microglobulin mutant
Class: immune system
Keywords: proline, D-Strand, beta bulge, amyloid, mutant, IMMUNE SYSTEM
Deposited on 2010-06-01, released 2011-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.217
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: NM_004048
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • expression tag (0)
      • engineered mutation (53)
    Domains in SCOPe 2.07: d3na4a1, d3na4a2
  • Heterogens: PE4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3na4A (A:)
    miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsplsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3na4A (A:)
    miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsplsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdr