PDB entry 3na3

View 3na3 on RCSB PDB site
Description: MutL protein homolog 1 isoform 1 from Homo sapiens
Deposited on 2010-06-01, released 2010-08-04
The last revision was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.231
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA mismatch repair protein Mlh1
    Species: Homo sapiens [TaxId:9606]
    Gene: COCA2, MLH1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ATP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3na3A (A:)
    gmsfvagvirrldetvvnriaageviqrpanaikemiencldakstsiqvivkegglkli
    qiqdngtgirkedldivcerfttsklqsfedlasistygfrgealasishvahvtittkt
    adgkcayrasysdgklkappkpcagnqgtqitvedlfyniatrrkalknpseeygkilev
    vgrysvhnagisfsvkkqgetvadvrtlpnastvdnirsifgnavsrelieigcedktla
    fkmngyisnanysvkkcifllfinhrlvestslrkaietvyaaylpknthpflylsleis
    pqnvdvnvhptkhevhflheesilervqqhieskllgsnssrmyftqt
    

    Sequence, based on observed residues (ATOM records):
    >3na3A (A:)
    fvagvirrldetvvnriaageviqrpanaikemiencldakstsiqvivkegglkliqiq
    dngtgirkedldivcerfttsklqsfgfrgealasishvahvtittktadgkcayrasys
    dgklkappkpcagnqgtqitvedlfyniatrrkalknpseeygkilevvgrysvhnagis
    fsvkkqgetvadvrtlpnastvdnirsifgnavsrelieigcedktlafkmngyisnany
    svkkcifllfinhrlvestslrkaietvyaaylpknthpflylsleisilervqqhiesk
    ll