PDB entry 3na2

View 3na2 on RCSB PDB site
Description: Crystal Structure of Protein of Unknown Function from Mine Drainage Metagenome Leptospirillum rubarum
Deposited on 2010-05-31, released 2010-07-28
The last revision was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.19
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Leptospirillum rubarum [TaxId:419542]
    Gene: UBAL2_80620259
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Leptospirillum rubarum [TaxId:419542]
    Gene: UBAL2_80620259
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Uncharacterized protein
    Species: Leptospirillum rubarum [TaxId:419542]
    Gene: UBAL2_80620259
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Uncharacterized protein
    Species: Leptospirillum rubarum [TaxId:419542]
    Gene: UBAL2_80620259
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACY, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3na2A (A:)
    mgsshhhhhhssgrenlyfqghvepgvtdrigqmilemfrtgmclfsvrspggvaelygg
    earkveitgtsltieredwhlhckletvetvvfdlspkdnggirmavvfrdkhqapvlra
    awlprlmpetpsppeqfwaftqryidlpmvvdarnrqlvfpgsgqggftegs
    

    Sequence, based on observed residues (ATOM records):
    >3na2A (A:)
    pgvtdrigqmilemfrtgmclfsvrspggvaelyggearkveitgtsltieredwhlhck
    letvetvvfdlspkdnggirmavvfrdkhqapvlraawlprlmpetpsppeqfwaftqry
    idlpmvvdarnrqlvfpg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3na2B (B:)
    mgsshhhhhhssgrenlyfqghvepgvtdrigqmilemfrtgmclfsvrspggvaelygg
    earkveitgtsltieredwhlhckletvetvvfdlspkdnggirmavvfrdkhqapvlra
    awlprlmpetpsppeqfwaftqryidlpmvvdarnrqlvfpgsgqggftegs
    

    Sequence, based on observed residues (ATOM records):
    >3na2B (B:)
    pgvtdrigqmilemfrtgmclfsvrspggvaelyggearkveitgtsltieredwhlhck
    letvetvvfdlspirmavvfrdkhqapvlraawlprlmpetpsppeqfwaftqryidlpm
    vvdarnrqlvf
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3na2C (C:)
    mgsshhhhhhssgrenlyfqghvepgvtdrigqmilemfrtgmclfsvrspggvaelygg
    earkveitgtsltieredwhlhckletvetvvfdlspkdnggirmavvfrdkhqapvlra
    awlprlmpetpsppeqfwaftqryidlpmvvdarnrqlvfpgsgqggftegs
    

    Sequence, based on observed residues (ATOM records):
    >3na2C (C:)
    gvtdrigqmilemfrtgmclfsvrspggvaelyggearkveitgtsltieredwhlhckl
    etvetvvfdlspkgirmavvfrdkhqapvlraawlprlmpetpsppeqfwaftqryidlp
    mvvdarnrqlv
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3na2D (D:)
    mgsshhhhhhssgrenlyfqghvepgvtdrigqmilemfrtgmclfsvrspggvaelygg
    earkveitgtsltieredwhlhckletvetvvfdlspkdnggirmavvfrdkhqapvlra
    awlprlmpetpsppeqfwaftqryidlpmvvdarnrqlvfpgsgqggftegs
    

    Sequence, based on observed residues (ATOM records):
    >3na2D (D:)
    pgvtdrigqmilemfrtgmclfsvrspggvaelyggearkveitgtsltieredwhlhck
    letvetvvfdlspkdnggirmavvfrdkhqapvlraawlprlmpetpsppeqfwaftqry
    idlpmvvdarnrqlvfp