PDB entry 3n9y

View 3n9y on RCSB PDB site
Description: Crystal structure of human CYP11A1 in complex with cholesterol
Class: Oxidoreductase, Electron transport
Keywords: cytochrome P450, cholesterol side chain cleavage, Structural Genomics, Structural Genomics Consortium, SGC, Oxidoreductase, Electron transport
Deposited on 2010-05-31, released 2011-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cholesterol side-chain cleavage enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP11A, CYP11A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n9ya_
  • Chain 'B':
    Compound: Cholesterol side-chain cleavage enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP11A, CYP11A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n9yb_
  • Chain 'C':
    Compound: adrenodoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: adrenodoxin, ADX, FDX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n9yc_
  • Chain 'D':
    Compound: adrenodoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: adrenodoxin, ADX, FDX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n9yd_
  • Heterogens: HEM, CLR, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n9yA (A:)
    strsprpfneipspgdngwlnlyhfwretgthkvhlhhvqnfqkygpiyreklgnvesvy
    vidpedvallfksegpnperflippwvayhqyyqrpigvllkksaawkkdrvalnqevma
    peatknflplldavsrdfvsvlhrrikkagsgnysgdisddlfrfafesitnvifgerqg
    mleevvnpeaqrfidaiyqmfhtsvpmlnlppdlfrlfrtktwkdhvaawdvifskadiy
    tqnfywelrqkgsvhhdyrgilyrllgdskmsfedikanvtemlaggvdttsmtlqwhly
    emarnlkvqdmlraevlaarhqaqgdmatmlqlvpllkasiketlrlhpisvtlqrylvn
    dlvlrdymipaktlvqvaiyalgreptfffdpenfdptrwlskdknityfrnlgfgwgvr
    qclgrriaelemtiflinmlenfrveiqhlsdvgttfnlilmpekpisftfwpfnqeatq
    qhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n9yA (A:)
    sprpfneipspgdngwlnlyhfwretgthkvhlhhvqnfqkygpiyreklgnvesvyvid
    pedvallfksegpnperflippwvayhqyyqrpigvllkksaawkkdrvalnqevmapea
    tknflplldavsrdfvsvlhrrikkagsgnysgdisddlfrfafesitnvifgerqgmle
    evvnpeaqrfidaiyqmfhtsvpmlnlppdlfrlfrtktwkdhvaawdvifskadiytqn
    fywelrqkgsvhhdyrgilyrllgdskmsfedikanvtemlaggvdttsmtlqwhlyema
    rnlkvqdmlraevlaarhqaqgdmatmlqlvpllkasiketlrlhpisvtlqrylvndlv
    lrdymipaktlvqvaiyalgreptfffdpenfdptrwlskdknityfrnlgfgwgvrqcl
    grriaelemtiflinmlenfrveiqhlsdvgttfnlilmpekpisftfwpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n9yB (B:)
    strsprpfneipspgdngwlnlyhfwretgthkvhlhhvqnfqkygpiyreklgnvesvy
    vidpedvallfksegpnperflippwvayhqyyqrpigvllkksaawkkdrvalnqevma
    peatknflplldavsrdfvsvlhrrikkagsgnysgdisddlfrfafesitnvifgerqg
    mleevvnpeaqrfidaiyqmfhtsvpmlnlppdlfrlfrtktwkdhvaawdvifskadiy
    tqnfywelrqkgsvhhdyrgilyrllgdskmsfedikanvtemlaggvdttsmtlqwhly
    emarnlkvqdmlraevlaarhqaqgdmatmlqlvpllkasiketlrlhpisvtlqrylvn
    dlvlrdymipaktlvqvaiyalgreptfffdpenfdptrwlskdknityfrnlgfgwgvr
    qclgrriaelemtiflinmlenfrveiqhlsdvgttfnlilmpekpisftfwpfnqeatq
    qhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n9yB (B:)
    prpfneipspgdngwlnlyhfwretgthkvhlhhvqnfqkygpiyreklgnvesvyvidp
    edvallfksegpnperflippwvayhqyyqrpigvllkksaawkkdrvalnqevmapeat
    knflplldavsrdfvsvlhrrikkagsgnysgdisddlfrfafesitnvifgerqgmlee
    vvnpeaqrfidaiyqmfhtsvpmlnlppdlfrlfrtktwkdhvaawdvifskadiytqnf
    ywelrqkgsvhhdyrgilyrllgdskmsfedikanvtemlaggvdttsmtlqwhlyemar
    nlkvqdmlraevlaarhqaqgdmatmlqlvpllkasiketlrlhpisvtlqrylvndlvl
    rdymipaktlvqvaiyalgreptfffdpenfdptrwlskdknityfrnlgfgwgvrqclg
    rriaelemtiflinmlenfrveiqhlsdvgttfnlilmpekpisftfwpf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n9yC (C:)
    ssedkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifed
    hiyekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n9yC (C:)
    slldvvvennldidgfgacegtlacstchlifedhiyekldaitdeendmldlaygltdr
    srlgcqic
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n9yD (D:)
    ssedkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifed
    hiyekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n9yD (D:)
    slldvvvennldidgfgacegtlacstchlifedhiyekldaitdeendmldlaygltdr
    srlgcqic