PDB entry 3n9x

View 3n9x on RCSB PDB site
Description: crystal structure of map kinase from plasmodium berghei, pb000659.00.0
Deposited on 2010-05-31, released 2010-07-28
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphotransferase
    Species: Plasmodium berghei [TaxId:5821]
    Gene: PB000659.00.0
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Z5A3 (18-End)
      • expression tag (10-17)
  • Chain 'B':
    Compound: Phosphotransferase
    Species: Plasmodium berghei [TaxId:5821]
    Gene: PB000659.00.0
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Z5A3 (18-End)
      • expression tag (9-17)
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n9xA (A:)
    mhhhhhhssgrenlyfqgiknvhvpdnyiikhligrgsygyvylaydknteknvaikkvn
    rmfedlidckrilreitilnrlksdyiirlydliipddllkfdelyivleiadsdlkklf
    ktpiflteehiktilynlllgenfihesgiihrdlkpancllnqdcsvkvcdfglartin
    sekdtnivndleeneepgphnknlkkqltshvvtrwyrapelillqenytksidiwstgc
    ifaellnmlqshindptnrfplfpgsscfplspdrnskkvheksnrdqlniifniigtpt
    eddlkninkpevikyiklfphrkpinlkqkypsisddginllesmlkfnpnkritidqal
    dhpylkdvrkkklenfstkkiilpfddwmvlsetqlryiflkevqsfhpelvipsvftih
    ennfynnekpss
    

    Sequence, based on observed residues (ATOM records):
    >3n9xA (A:)
    renlyfqgiknvhvpdnyiikhligrgsygyvylaydknteknvaikkvnrmfedlidck
    rilreitilnrlksdyiirlydliipddllkfdelyivleiadsdlkklfktpiflteeh
    iktilynlllgenfihesgiihrdlkpancllnqdcsvkvcdfglartihvvtrwyrape
    lillqenytksidiwstgcifaellnmlqshindptnrfplfpgsscfpheksnrdqlni
    ifniigtpteddlkninkpevikyiklfphrkpinlkqkypsisddginllesmlkfnpn
    kritidqaldhpylkdvrkkkletkkiilpfddwmvlsetqlryiflkevqsfhpelvip
    svftihennfynne
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n9xB (B:)
    mhhhhhhssgrenlyfqgiknvhvpdnyiikhligrgsygyvylaydknteknvaikkvn
    rmfedlidckrilreitilnrlksdyiirlydliipddllkfdelyivleiadsdlkklf
    ktpiflteehiktilynlllgenfihesgiihrdlkpancllnqdcsvkvcdfglartin
    sekdtnivndleeneepgphnknlkkqltshvvtrwyrapelillqenytksidiwstgc
    ifaellnmlqshindptnrfplfpgsscfplspdrnskkvheksnrdqlniifniigtpt
    eddlkninkpevikyiklfphrkpinlkqkypsisddginllesmlkfnpnkritidqal
    dhpylkdvrkkklenfstkkiilpfddwmvlsetqlryiflkevqsfhpelvipsvftih
    ennfynnekpss
    

    Sequence, based on observed residues (ATOM records):
    >3n9xB (B:)
    grenlyfqgiknvhvpdnyiikhligrgsygyvylaydknteknvaikkvnrmfedlidc
    krilreitilnrlksdyiirlydliipddllkfdelyivleiadsdlkklfktpifltee
    hiktilynlllgenfihesgiihrdlkpancllnqdcsvkvcdfglartinshvvtrwyr
    apelillqenytksidiwstgcifaellnmlqshindptnrfplfpgsscfheksnrdql
    niifniigtpteddlknikpevikyiklfphrkpinlkqkypsisddginllesmlkfnp
    nkritidqaldhpylkdvrkkkletkkiilpfddwmvlsetqlryiflkevqsfhpelvi
    psvftihennfynn