PDB entry 3n9w

View 3n9w on RCSB PDB site
Description: Crystal structure of 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (IspD) in complex with 1,2-Propanediol
Class: transferase
Keywords: YGBP, CYTIDYLYLTRANSFERASE, DEOXYXYLULOSE-5-PHOSPHATE PATHWAY (DXP), ISOPRENOID BIOSYNTHESIS, 1, 2-Propanediol, FBLD, TRANSFERASE
Deposited on 2010-05-31, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n9wa_
  • Chain 'B':
    Compound: 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n9wb_
  • Heterogens: PGO, PGR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n9wA (A:)
    atthldvcavvpaagfgrrmqtecpkqylsignqtilehsvhallahprvkrvviaispg
    dsrfaqlplanhpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarll
    alsetsrtggilaapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltra
    lnegatitdeasaleycgfhpqlvegradnikvtrpedlalaefyltrtihqent
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n9wA (A:)
    ldvcavvpaanqtilehsvhallahprvkrvviaiplanhpqitvvdggderadsvlagl
    kaagdaqwvlvhdaarpclhqddlarllalsetsrtggilaapvrdtmkraepgknaiah
    tvdrnglwhaltpqffprellhdcltralnegatitdeasaleycgfhpqlvegradnik
    vtrpedlalaefylt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n9wB (B:)
    atthldvcavvpaagfgrrmqtecpkqylsignqtilehsvhallahprvkrvviaispg
    dsrfaqlplanhpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarll
    alsetsrtggilaapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltra
    lnegatitdeasaleycgfhpqlvegradnikvtrpedlalaefyltrtihqent
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n9wB (B:)
    ldvcavvpaagkqylsignqtilehsvhallahprvkrvviaispgdsrfaqlplanhpq
    itvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarllalsetsrtggilaa
    pvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltralnegatitdeasal
    eycgfhpqlvegradnikvtrpedlalaefyltrtihqen