PDB entry 3n9v

View 3n9v on RCSB PDB site
Description: Crystal Structure of INPP5B
Deposited on 2010-05-31, released 2010-07-28
The last revision was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.191
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II inositol-1,4,5-trisphosphate 5-phosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: Inpp5b
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32019 (1-End)
      • initiating methionine (0)
  • Chain 'B':
    Compound: Type II inositol-1,4,5-trisphosphate 5-phosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: Inpp5b
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32019 (1-End)
      • initiating methionine (0)
  • Heterogens: MG, CA, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n9vA (A:)
    miqnfrffagtynvngqspkeclrlwlsngiqapdvycvgfqeldlskeafffhdtpkee
    ewfkavseglhpdakyakvklirlvgimlllyvkqehaayiseveaetvgtgimgrmgnk
    ggvairfqfhntsicvvnshlaahieeyerrnqdykdicsrmqfcqpdpslppltisnhd
    vilwlgdlnyrieeldvekvkklieekdfqmlyaydqlkiqvaaktvfegftegeltfqp
    tykydtgsddwdtsekcrapawcdrilwkgknitqlsyqshmalktsdhkpvssvfdigv
    rvvndeahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n9vA (A:)
    miqnfrffagtynvngqspkeclrlwlsngiqapdvycvgfqeldlskeafffhdtpkee
    ewfkavseglhpdakyakvklirlvgimlllyvkqehaayiseveaetvgtgimgrmgnk
    ggvairfqfhntsicvvnshlaahieeyerrnqdykdicsrmqfcqpdpslppltisnhd
    vilwlgdlnyrieeldvekvkklieekdfqmlyaydqlkiqvaaktvfegftegeltfqp
    tykydtgsddwdtsrapawcdrilwkgknitqlsyqshmalktsdhkpvssvfdigvrvv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n9vB (B:)
    miqnfrffagtynvngqspkeclrlwlsngiqapdvycvgfqeldlskeafffhdtpkee
    ewfkavseglhpdakyakvklirlvgimlllyvkqehaayiseveaetvgtgimgrmgnk
    ggvairfqfhntsicvvnshlaahieeyerrnqdykdicsrmqfcqpdpslppltisnhd
    vilwlgdlnyrieeldvekvkklieekdfqmlyaydqlkiqvaaktvfegftegeltfqp
    tykydtgsddwdtsekcrapawcdrilwkgknitqlsyqshmalktsdhkpvssvfdigv
    rvvndeahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n9vB (B:)
    miqnfrffagtynvngqspkeclrlwlsngiqapdvycvgfqeldlskeafffhdtpkee
    ewfkavseglhpdakyakvklirlvgimlllyvkqehaayiseveaetvgtgimgrmgnk
    ggvairfqfhntsicvvnshlaahieeyerrnqdykdicsrmqfcltisnhdvilwlgdl
    nyrieeldvekvkklieekdfqmlyaydqlkiqvaaktvfegftegeltfqptykydtgs
    ddwdapawcdrilwkgknitqlsyqshmalktsdhkpvssvfdigvrvv