PDB entry 3n9u

View 3n9u on RCSB PDB site
Description: Crystal Structure of the Complex between the 25 kDa Subunit and the 59 kDa Subunit (RRM domain) of Human Cleavage Factor Im
Class: splicing
Keywords: Protein-protein complex, Coexpression, Heterotetramer, mRNA maturation, polyadenylation, mRNA cleavage, cleavage and polyadenylation specificity factor subunit 5, cleavage and polyadenylation specificity factor subunit 7, pre-mRNA cleavage factor Im 25 kDa subunit, pre-mRNA cleavage factor Im 59 kDa subunit, NUDIX, hydrolase, RRM domain, NUDT21, CPSF5, CPSF7, Structural Genomics, Structural Genomics Consortium, SGC, SGC Stockholm, SPLICING
Deposited on 2010-05-31, released 2010-07-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.198
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cleavage and polyadenylation specificity factor subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CFIM25, CPSF25, CPSF5, NUDT21
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Cleavage and polyadenylation specificity factor subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CFIM25, CPSF25, CPSF5, NUDT21
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Cleavage and polyadenylation specificity factor subunit 7
    Species: Homo sapiens [TaxId:9606]
    Gene: CPSF7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3n9uc_
  • Chain 'I':
    Compound: Cleavage and polyadenylation specificity factor subunit 7
    Species: Homo sapiens [TaxId:9606]
    Gene: CPSF7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3n9ui_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >3n9uC (C:)
mhhhhhhssgvdlgtenlyfqsmeppppvrqepspkpnnktpailytysglrnrraavyv
gsfswwttdqqliqvirsigvydvvelkfaenrangqskgyaevvvasensvhkllellp
gkvlngekvdvrpatrqnlsqfeaqarkrecvrvpr

    Sequence, based on observed residues (ATOM records): (download) 
    >3n9uC (C:)
aavyvgsfswwttdqqliqvirsigvydvvelkfaenrangqskgyaevvvasensvhkl
lellpgkvlngekvdvrpatrqnlsqfeaqarkrec

  • Chain 'I':
    Sequence, based on SEQRES records: (download) 
    >3n9uI (I:)
mhhhhhhssgvdlgtenlyfqsmeppppvrqepspkpnnktpailytysglrnrraavyv
gsfswwttdqqliqvirsigvydvvelkfaenrangqskgyaevvvasensvhkllellp
gkvlngekvdvrpatrqnlsqfeaqarkrecvrvpr

    Sequence, based on observed residues (ATOM records): (download) 
    >3n9uI (I:)
vyvgsfswwttdqqliqvirsigvydvvelkfaenrangqskgyaevvvvhkllellpgk
vlngekvdvrpatrqnlsqfeaqarkr