PDB entry 3n9t

View 3n9t on RCSB PDB site
Description: cryatal structure of hydroxyquinol 1,2-dioxygenase from pseudomonas putida dll-e4
Deposited on 2010-05-31, released 2010-08-04
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PnpC
    Species: Pseudomonas putida [TaxId:303]
    Gene: pnpC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HGX, FLC, FE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n9tA (A:)
    mtdhykavealisdqavdsfetspnprfkqimqslvrhlhdfvsevelteqewfegirfl
    tatgqkcdgkvrqefillsdtlgvsmlvdainhrqstnatettvfgpffiegmpdrgyge
    nmaltdgvpalvygrvldvqgrpvvgavldvwqtadngmysgqdpdqpfgnlrgryrsdn
    dgcfaiqttvpvcypiptdgpvgemldaanrhawrpahlhfmiqapgyrklvthlfnsdd
    pyldsdavfgvkgslqvkyedrpahdedaggldmpypyksayyefvmeae
    

    Sequence, based on observed residues (ATOM records):
    >3n9tA (A:)
    ykavealisdqavdsfetspnprfkqimqslvrhlhdfvsevelteqewfegirfltatg
    qkcdgkvrqefillsdtlgvsmlvdainhrqstnatettvfgpffiegmpdrgygenmal
    tdgvpalvygrvldvqgrpvvgavldvwqtadngmysgqdpdqpfgnlrgryrsdndgcf
    aiqttvpvcypiptdgpvgemldaanrhawrpahlhfmiqapgyrklvthlfnsddpyld
    sdavfgvkgslqvkyedrpahdedaggldmpypyksayyefvmeae