PDB entry 3n9m

View 3n9m on RCSB PDB site
Description: ceKDM7A from C.elegans, alone
Deposited on 2010-05-31, released 2010-06-30
The last revision was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.204
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: F29B9.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Putative uncharacterized protein
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: F29B9.2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE2, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n9mA (A:)
    efhmeqktpkesdrcggcgkftheddlialeeekkkekekplmskkkshhhkkndfqwig
    cdscqtwyhflcsgleqfeyylyekffcpkcvphtghsirykvvaphryrwyspnekhlg
    ievgsktwiedfitrentvpsptddevcivedgyefrrefeklggadnwgkvfmvkdmdg
    lnmtmpkpgfdledvvkimgsdyevdtidvynqstysmkldtfrklfrdtknrpllynfl
    slefsdnnemkeiakpprfvqeismvnrlwpdvsgaeyikllqreeylpedqrpkveqfc
    lagmagsytdfhvdfggssvyyhilkgekifyiaapteqnfaayqahetspdtttwfgdi
    angavkrvvikegqtllipagwihavltpvdslvfggnflhlgnlemqmrvyhlenairk
    eirseekfyfpnfellhwmymrnvllekiteanqegsdmreqekniwtasqimkaemerw
    mdrelrlgpeknailptddknkimisvrkqieiqtkiqnaknkpmglk
    

    Sequence, based on observed residues (ATOM records):
    >3n9mA (A:)
    kesdrcggcgkftheddlikplmskkkshhhkkndfqwigcdscqtwyhflcsgleqfey
    ylyekffcpkcvphtghsirykvvaphryrwyspnekhlgievgsktwiedfitrentvp
    sptddevcivedgyefrrefeklggadnwgkvfmvkdmdglnmtmpkpgfdledvvkimg
    sdyevdtidvynqstysmkldtfrklfrdtknrpllynflslefsdnnemkeiakpprfv
    qeismvnrlwpdvsgaeyikllqreeylpedqrpkveqfclagmagsytdfhvdfggssv
    yyhilkgekifyiaapteqnfaayqahetspdtttwfgdiangavkrvvikegqtllipa
    gwihavltpvdslvfggnflhlgnlemqmrvyhlenairkeirseekfyfpnfellhwmy
    mrnvllekiteanqegsdmreqekniwtasqimkaemerwmdrelrlgpeknailptddk
    nkimisvrkqieiqtkiqnaknk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n9mC (C:)
    efhmeqktpkesdrcggcgkftheddlialeeekkkekekplmskkkshhhkkndfqwig
    cdscqtwyhflcsgleqfeyylyekffcpkcvphtghsirykvvaphryrwyspnekhlg
    ievgsktwiedfitrentvpsptddevcivedgyefrrefeklggadnwgkvfmvkdmdg
    lnmtmpkpgfdledvvkimgsdyevdtidvynqstysmkldtfrklfrdtknrpllynfl
    slefsdnnemkeiakpprfvqeismvnrlwpdvsgaeyikllqreeylpedqrpkveqfc
    lagmagsytdfhvdfggssvyyhilkgekifyiaapteqnfaayqahetspdtttwfgdi
    angavkrvvikegqtllipagwihavltpvdslvfggnflhlgnlemqmrvyhlenairk
    eirseekfyfpnfellhwmymrnvllekiteanqegsdmreqekniwtasqimkaemerw
    mdrelrlgpeknailptddknkimisvrkqieiqtkiqnaknkpmglk
    

    Sequence, based on observed residues (ATOM records):
    >3n9mC (C:)
    kesdrcggcgkfthemskkkshhhkkndfqwigcdscqtwyhflcsgleqfeyylyekff
    cpkcvphtghsirykvvaphryrwyspnekhlgievgsktwiedfitrentvpsptddev
    civedgyefrrefeklggadnwgkvfmvkdmdglnmtmpkpgfdledvvkimgsdyevdt
    idvynqstysmkldtfrklfrdtknrpllynflslefsdnnemkeiakpprfvqeismvn
    rlwpylpedqrpkveqfclagmagsytdfhvdfggssvyyhilkgekifyiaapteqnfa
    ayqahetspdtttwfgdiangavkrvvikegqtllipagwihavltpvdslvfggnflhl
    gnlemqmrvyhlenairkeirseekfyfpnfellhwmymrnvllekiteanqegsdmreq
    ekniwtasqimkaemerwmdrelrlgpeknailptddknkimisvrkqieiqtkiqnakn
    k