PDB entry 3n9k

View 3n9k on RCSB PDB site
Description: F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A
Class: hydrolase
Keywords: Aromatic entranceway/clamp, Exoglucanase, Glycoside hydrolase, Protein-carbohydrate interaction, Site-directed mutagenesis, Laminaritriose, hydrolase
Deposited on 2010-05-30, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.154
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucan 1,3-beta-glucosidase
    Species: Candida albicans [TaxId:5476]
    Gene: XOG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29717 (Start-398)
      • see remark 999 (62)
      • engineered mutation (227)
      • engineered mutation (290)
    Domains in SCOPe 2.07: d3n9ka_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n9kA (A:)
    gghnvawdydnnvirgvnlggwfvlepymtpslfepfqngndqsgvpvdeyhwtqtlgke
    aalrilqkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekalg
    warknnirvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggneys
    dvvigiellneplgpvlnmdklkqffldgynslrqtgsvtpviihdaaqvfgywnnfltv
    aegqwnvvvdhhhyqvfsggelsrnindhisvacnwgwdakkeshwnvagswsaaltdca
    kwlngvnrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggwv
    fwswktenapewsfqtltynglfpqpvtdrqfpnqcgfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n9kA (A:)
    awdydnnvirgvnlggwfvlepymtpslfepfqngndqsgvpvdeyhwtqtlgkeaalri
    lqkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekalgwarkn
    nirvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggneysdvvig
    iellneplgpvlnmdklkqffldgynslrqtgsvtpviihdaaqvfgywnnfltvaegqw
    nvvvdhhhyqvfsggelsrnindhisvacnwgwdakkeshwnvagswsaaltdcakwlng
    vnrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggwvfwswk
    tenapewsfqtltynglfpqpvtdrqfpnqcgfh