PDB entry 3n9d

View 3n9d on RCSB PDB site
Description: Monoclinic Structure of P. aeruginosa LigD phosphoesterase domain
Deposited on 2010-05-28, released 2010-08-11
The last revision was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable ATP-dependent DNA ligase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: NP_250828.1, PA2138
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, SO4, YT3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n9dA (A:)
    rqtpepsgrkprkdstgllrycvqkhdasrlhydfrleldgtlkswavpkgpcldpavkr
    lavqvedhpldyadfegsipqghygagdvivwdrgawtplddpreglekghlsfaldgek
    lsgrwhlirtnlrgkqsqwflvkakdgearsldrfdvlkerpdsvlsertl
    

    Sequence, based on observed residues (ATOM records):
    >3n9dA (A:)
    llrycvqkhdasrlhydfrleldgtlkswavpkgpcldpavkrlavqvedhpldyadfeg
    sipqghagdvivwdrgawtplddpreglekghlsfaldgeklsgrwhlirtnlrgkqsqw
    flvkakdgearsldrfdvlkerpdsvls