PDB entry 3n9b

View 3n9b on RCSB PDB site
Description: Crystal Structure of the P. aeruginosa LigD phosphoesterase domain
Deposited on 2010-05-28, released 2010-08-11
The last revision was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.153
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable ATP-dependent DNA ligase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: LigD, PA2138
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: probable ATP-dependent DNA ligase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: LigD, PA2138
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, CL, PEG, MN, YT3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n9bA (A:)
    rqtpepsgrkprkdstgllrycvqkhdasrlhydfrleldgtlkswavpkgpcldpavkr
    lavqvedhpldyadfegsipqghygagdvivwdrgawtplddpreglekghlsfaldgek
    lsgrwhlirtnlrgkqsqwflvkakdgearsldrfdvlkerpdsvlsertl
    

    Sequence, based on observed residues (ATOM records):
    >3n9bA (A:)
    llrycvqkhdasrlhydfrleldgtlkswavpkgpcldpavkrlavqvedhpldyadfeg
    sipqagdvivwdrgawtplddpreglekghlsfaldgeklsgrwhlirtnlrgkqsqwfl
    vkakdgearsldrfdvlkerpdsvlser
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n9bB (B:)
    rqtpepsgrkprkdstgllrycvqkhdasrlhydfrleldgtlkswavpkgpcldpavkr
    lavqvedhpldyadfegsipqghygagdvivwdrgawtplddpreglekghlsfaldgek
    lsgrwhlirtnlrgkqsqwflvkakdgearsldrfdvlkerpdsvlsertl
    

    Sequence, based on observed residues (ATOM records):
    >3n9bB (B:)
    dstgllrycvqkhdasrlhydfrleldgtlkswavpkgpcldpavkrlavqvedhpldya
    dfegsipqhygagdvivwdrgawtplddpreglekghlsfaldgeklsgrwhlirtnlrg
    kqsqwflvkakdgearsldrfdvlkerpdsvlsertl