PDB entry 3n99

View 3n99 on RCSB PDB site
Description: Crystal structure of TM1086
Deposited on 2010-05-28, released 2010-06-16
The last revision was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.153
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (6-7)
  • Chain 'B':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (6-7)
  • Chain 'C':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (6-7)
  • Chain 'D':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (6-7)
  • Chain 'E':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (6-7)
  • Chain 'G':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (2-7)
  • Chain 'H':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (7)
  • Chain 'I':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (7)
  • Chain 'J':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (7)
  • Chain 'K':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (7)
  • Chain 'L':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (6-7)
  • Chain 'M':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (6-7)
  • Chain 'N':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (6-7)
  • Chain 'O':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (6-7)
  • Chain 'P':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (6-7)
  • Chain 'S':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (7)
  • Chain 'T':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (7)
  • Chain 'U':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (7)
  • Chain 'V':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (7)
  • Chain 'X':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (7)
  • Chain 'a':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (6-7)
  • Chain 'b':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (6-7)
  • Chain 'c':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (6-7)
  • Chain 'd':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (6-7)
  • Chain 'e':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (6-7)
  • Chain 'g':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (2-7)
  • Chain 'h':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (7)
  • Chain 'i':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (6-7)
  • Chain 'j':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (6-7)
  • Chain 'k':
    Compound: uncharacterized protein TM1086
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1086
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0H2 (8-End)
      • expression tag (7)
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n99A (A:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99A (A:)
    ghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwag
    dhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfee
    evlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakip
    ahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsi
    gvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n99B (B:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99B (B:)
    ghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwag
    dhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfee
    evlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakip
    ahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsi
    gvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n99C (C:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99C (C:)
    ghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwag
    dhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfee
    evlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakip
    ahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsi
    gvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n99D (D:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99D (D:)
    ghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwag
    dhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfee
    evlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakip
    ahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsi
    gvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3n99E (E:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99E (E:)
    ghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwag
    dhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfee
    evlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakip
    ahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsi
    gvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3n99G (G:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99G (G:)
    hhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsay
    gwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlv
    hfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvv
    akipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkg
    avsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3n99H (H:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99H (H:)
    hmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwagd
    hvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfeee
    vlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakipa
    hmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsig
    vvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >3n99I (I:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99I (I:)
    hmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwagd
    hvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfeee
    vlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakipa
    hmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsig
    vvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >3n99J (J:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99J (J:)
    hmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwagd
    hvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfeee
    vlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakipa
    hmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsig
    vvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >3n99K (K:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99K (K:)
    hmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwagd
    hvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfeee
    vlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakipa
    hmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsig
    vvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >3n99L (L:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99L (L:)
    ghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwag
    dhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfee
    evlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakip
    ahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsi
    gvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >3n99M (M:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99M (M:)
    ghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwag
    dhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfee
    evlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakip
    ahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsi
    gvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >3n99N (N:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99N (N:)
    ghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwag
    dhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfee
    evlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakip
    ahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsi
    gvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >3n99O (O:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99O (O:)
    ghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwag
    dhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfee
    evlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakip
    ahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsi
    gvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >3n99P (P:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99P (P:)
    ghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwag
    dhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfee
    evlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakip
    ahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsi
    gvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >3n99S (S:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99S (S:)
    hmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwagd
    hvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfeee
    vlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakipa
    hmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsig
    vvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >3n99T (T:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99T (T:)
    hmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwagd
    hvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfeee
    vlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakipa
    hmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsig
    vvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylv
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >3n99U (U:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99U (U:)
    hmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwagd
    hvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfeee
    vlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakipa
    hmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsig
    vvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >3n99V (V:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99V (V:)
    hmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwagd
    hvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfeee
    vlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakipa
    hmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsig
    vvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylv
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >3n99X (X:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99X (X:)
    hmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwagd
    hvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfeee
    vlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakipa
    hmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsig
    vvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'a':
    Sequence, based on SEQRES records:
    >3n99a (a:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99a (a:)
    ghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwag
    dhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfee
    evlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakip
    ahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsi
    gvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'b':
    Sequence, based on SEQRES records:
    >3n99b (b:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99b (b:)
    ghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwag
    dhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfee
    evlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakip
    ahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsi
    gvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'c':
    Sequence, based on SEQRES records:
    >3n99c (c:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99c (c:)
    ghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwag
    dhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfee
    evlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakip
    ahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsi
    gvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'd':
    Sequence, based on SEQRES records:
    >3n99d (d:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99d (d:)
    ghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwag
    dhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfee
    evlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakip
    ahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsi
    gvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'e':
    Sequence, based on SEQRES records:
    >3n99e (e:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99e (e:)
    ghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwag
    dhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfee
    evlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakip
    ahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsi
    gvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylv
    

  • Chain 'g':
    Sequence, based on SEQRES records:
    >3n99g (g:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99g (g:)
    hhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsay
    gwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlv
    hfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvv
    akipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkg
    avsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylv
    

  • Chain 'h':
    Sequence, based on SEQRES records:
    >3n99h (h:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99h (h:)
    hmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwagd
    hvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfeee
    vlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakipa
    hmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsig
    vvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'i':
    Sequence, based on SEQRES records:
    >3n99i (i:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99i (i:)
    ghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwag
    dhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfee
    evlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakip
    ahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsi
    gvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'j':
    Sequence, based on SEQRES records:
    >3n99j (j:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99j (j:)
    ghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwag
    dhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfee
    evlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakip
    ahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsi
    gvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdyl
    

  • Chain 'k':
    Sequence, based on SEQRES records:
    >3n99k (k:)
    hhhhhhghmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgds
    aygwagdhvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhv
    lvhfeeevlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvp
    vvakipahmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyr
    kgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylvr
    

    Sequence, based on observed residues (ATOM records):
    >3n99k (k:)
    hmrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwagd
    hvepgvsvmarrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfeee
    vlgklmvgdkilikawgqglklldhpdvkvmnidpdlfeklgiqekngkihvpvvakipa
    hmmgsgigasssastdydimasnpedlgvadlklgdivaiqdhdnsygvgkyrkgavsig
    vvvhsacvsaghgpgvvvimtgdeskilpeeveranisdylv