PDB entry 3n97

View 3n97 on RCSB PDB site
Description: RNA polymerase alpha C-terminal domain (E. coli) and sigma region 4 (T. aq. mutant) bound to (UP,-35 element) DNA
Deposited on 2010-05-28, released 2011-06-08
The last revision was dated 2011-06-08, with a file datestamp of 2011-06-03.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.257
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase sigma factor
    Species: Thermus aquaticus [TaxId:271]
    Gene: rpoS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EZJ8
      • engineered mutation (20)
      • see remark 999 (58)
      • see remark 999 (60)
  • Chain 'B':
    Compound: DNA-directed RNA polymerase subunit alpha
    Species: Escherichia coli [TaxId:83333]
    Gene: b3295, JW3257, pez, phs, rpoA, sez
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA-directed RNA polymerase subunit alpha
    Species: Escherichia coli [TaxId:83333]
    Gene: b3295, JW3257, pez, phs, rpoA, sez
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: RNA polymerase sigma factor
    Species: Thermus aquaticus [TaxId:271]
    Gene: rpoS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EZJ8
      • engineered mutation (20)
      • see remark 999 (58)
  • Chain 'M':
    Compound: DNA (5'-d(*tp*gp*gp*ap*ap*ap*ap*ap*ap*gp*tp*ap*cp*tp*tp*gp*ap*cp*ap*tp*gp*g)-3')
  • Chain 'N':
    Compound: DNA (5'-d(*cp*cp*ap*tp*gp*tp*cp*ap*ap*gp*tp*ap*cp*tp*tp*tp*tp*tp*tp*cp*c)-3')
  • Heterogens: ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n97A (A:)
    seelekalsklsereamvlkmrkglidgrehtleevgayfgvtrerirqienkalrklrh
    psrseklrdfle
    

    Sequence, based on observed residues (ATOM records):
    >3n97A (A:)
    sklsereamvlkmrkglidgrehtleevgayfgvtrerirqienkalrklrhp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n97B (B:)
    kpefdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikd
    vlasrglslgmrlenwppasiade
    

    Sequence, based on observed residues (ATOM records):
    >3n97B (B:)
    dpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvlas
    rglslgmrlenwppa
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n97C (C:)
    kpefdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikd
    vlasrglslgmrlenwppasiade
    

    Sequence, based on observed residues (ATOM records):
    >3n97C (C:)
    dpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvlas
    rglslgmrlenwpp
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n97D (D:)
    seelekalsklsereamvlkmrkglidgrehtleevgayfgvtrerirqienkalrklrh
    psrseklrdfle
    

    Sequence, based on observed residues (ATOM records):
    >3n97D (D:)
    klsereamvlkmrkglidgrehtleevgayfgvtrerirqienkalrklr
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.