PDB entry 3n95

View 3n95 on RCSB PDB site
Description: Crystal structure of human CRFR2 alpha extracellular domain in complex with Urocortin 2
Deposited on 2010-05-28, released 2010-10-20
The last revision was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: 0.226
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maltose binding protein-CRFR2 alpha extracellular domain
    Species: Homo sapiens [TaxId:9606]
    Gene: Human CRFR2 alpha
    Database cross-references and differences (RAF-indexed):
    • PDB 3N95
  • Chain 'B':
    Compound: Maltose binding protein-CRFR2 alpha extracellular domain
    Species: Homo sapiens [TaxId:9606]
    Gene: Human CRFR2 alpha
    Database cross-references and differences (RAF-indexed):
    • PDB 3N95
  • Chain 'C':
    Compound: Maltose binding protein-CRFR2 alpha extracellular domain
    Species: Homo sapiens [TaxId:9606]
    Gene: Human CRFR2 alpha
    Database cross-references and differences (RAF-indexed):
    • PDB 3N95
  • Chain 'D':
    Compound: Maltose binding protein-CRFR2 alpha extracellular domain
    Species: Homo sapiens [TaxId:9606]
    Gene: Human CRFR2 alpha
    Database cross-references and differences (RAF-indexed):
    • PDB 3N95
  • Chain 'E':
    Compound: Urocortin-2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Urocortin-2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MAL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n95A (A:)
    makieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpd
    iifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliyn
    kdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydi
    kdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidts
    kvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkp
    lgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvd
    ealkdaqtnaaaefaallhslleancslalaeellldgwgppldpegpysycnttldqig
    tcwprsaagalverpcpeyfngvkynttrnayreclengtwaskinysqcepilddhhhh
    hh
    

    Sequence, based on observed residues (ATOM records):
    >3n95A (A:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
    lkdaqtnaaaefaallhslleancslalaeellldgwgppldpegpysycnttldqigtc
    wprsaagalverpcpeyfngvkynttrnayreclengtwaskinysqcep
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n95B (B:)
    makieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpd
    iifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliyn
    kdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydi
    kdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidts
    kvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkp
    lgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvd
    ealkdaqtnaaaefaallhslleancslalaeellldgwgppldpegpysycnttldqig
    tcwprsaagalverpcpeyfngvkynttrnayreclengtwaskinysqcepilddhhhh
    hh
    

    Sequence, based on observed residues (ATOM records):
    >3n95B (B:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
    lkdaqtnaaaefaallhslleancslalaeellldgwgppldpegpysycnttldqigtc
    wprsaagalverpcpeyfngvkynttrnayreclengtwaskinysqcepil
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n95C (C:)
    makieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpd
    iifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliyn
    kdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydi
    kdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidts
    kvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkp
    lgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvd
    ealkdaqtnaaaefaallhslleancslalaeellldgwgppldpegpysycnttldqig
    tcwprsaagalverpcpeyfngvkynttrnayreclengtwaskinysqcepilddhhhh
    hh
    

    Sequence, based on observed residues (ATOM records):
    >3n95C (C:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
    lkdaqtnaaaefaallhslleancslalaeellldgysycnttldqigtcwprsaagalv
    erpcpeyfngvkynttrnayreclengtwaskinysqcepil
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n95D (D:)
    makieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpd
    iifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliyn
    kdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydi
    kdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidts
    kvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkp
    lgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvd
    ealkdaqtnaaaefaallhslleancslalaeellldgwgppldpegpysycnttldqig
    tcwprsaagalverpcpeyfngvkynttrnayreclengtwaskinysqcepilddhhhh
    hh
    

    Sequence, based on observed residues (ATOM records):
    >3n95D (D:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
    lkdaqtnaaaefaallhslleancslalaeellldgysycnttldqigtcwprsaagalv
    erpcpeyfngvkynttrnayreclengtwaskinysqcepild
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >3n95E (E:)
    aareqattnarilarv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >3n95F (F:)
    aareqattnarilarv