PDB entry 3n94

View 3n94 on RCSB PDB site
Description: crystal structure of human pituitary adenylate cyclase 1 receptor- short n-terminal extracellular domain
Deposited on 2010-05-28, released 2011-06-08
The last revision was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fusion protein of Maltose-binding periplasmic protein and pituitary adenylate cyclase 1 Receptor-short
    Species: Homo sapiens [TaxId:9606]
    Gene: malE, b4034, JW3994, ADCYAP1R1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEX9 (Start-367)
      • linker (368-374)
    • Uniprot B8ZZK3 (375-468)
  • Heterogens: MAL, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n94A (A:)
    makieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpd
    iifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliyn
    kdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydi
    kdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidts
    kvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkp
    lgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvd
    ealkdaqtnaaaefaifkkeqamclekiqranelmgfndsspgcpgmwdnitcwkpahvg
    emvlvscpelfrifnpdqdmgvvsrnctedgwsepfphyfdacgfdeyehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n94A (A:)
    ieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiif
    wahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdl
    lpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdv
    gvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvn
    ygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplga
    valksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdeal
    kdaqtnaaaefaifkkeqamclekiqranelmgfndsspgcpgmwdnitcwkpahvgemv
    lvscpelfrifnpdqdmgvvsrnctedgwsepfphyfdacgfdeye