PDB entry 3n90

View 3n90 on RCSB PDB site
Description: The 1.7 Angstrom resolution crystal structure of AT2G44920, a pentapeptide repeat protein from Arabidopsis thaliana thylakoid lumen.
Class: unknown function
Keywords: right-handed quadrilateral beta helix, pentapeptide repeat protein, repeated-five residue fold, chloroplast lumen, UNKNOWN FUNCTION
Deposited on 2010-05-28, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.228
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thylakoid lumenal 15 kDa protein 1, chloroplastic
    Species: ARABIDOPSIS THALIANA [TaxId:3702]
    Gene: At2g44920, T13E15.7
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22160 (0-143)
      • engineered mutation (92-93)
      • expression tag (144)
    Domains in SCOPe 2.07: d3n90a1, d3n90a2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n90A (A:)
    afkgggpygqgvtrgqdlsgkdfsgqtlirqdfktsilrqanfkgakllgasffdadltg
    adlseadlrgadfslanvtkvnltnanlegatmmgntsfkgsnitgadftdvplrddqrv
    ylckvadgvnattgnatrdtllcnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n90A (A:)
    afkgggpygqgvtrgqdlsgkdfsgqtlirqdfktsilrqanfkgakllgasffdadltg
    adlseadlrgadfslanvtkvnltnanlegatmmgntsfkgsnitgadftdvplrddqrv
    ylckvadgvnattgnatrdtllcnl