PDB entry 3n8v

View 3n8v on RCSB PDB site
Description: Crystal Structure of Unoccupied Cyclooxygenase-1
Deposited on 2010-05-28, released 2010-07-28
The last revision was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.204
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prostaglandin G/H synthase 1
    Species: Ovis aries [TaxId:9940]
    Gene: COX1, PTGS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05979 (0-552)
      • conflict (60)
  • Chain 'B':
    Compound: Prostaglandin G/H synthase 1
    Species: Ovis aries [TaxId:9940]
    Gene: COX1, PTGS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05979 (0-552)
      • conflict (60)
  • Heterogens: HEM, BOG, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3n8vA (A:)
    pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipeiwtwlrttlrpspsfihf
    llthgrwlwdfvnatfirdtlmrlvltvrsnlipspptyniahdyiswesfsnvsyytri
    lpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqgtnlmfaffaqhfthqffk
    tsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklkyqmlngevyppsveeapv
    lmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvcdllkaehptwgdeqlfqt
    arliligetikivieeyvqqlsgyflqlkfdpellfgaqfqyrnriamefnqlyhwhplm
    pdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagrigggrnidhhilhvavdv
    ikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaeleelygdidalefypglllek
    chpnsifgesmiemgapfslkgllgnpicspeywkastfggevgfnlvktatlkklvcln
    tktcpyvsfhvpd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3n8vB (B:)
    pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipeiwtwlrttlrpspsfihf
    llthgrwlwdfvnatfirdtlmrlvltvrsnlipspptyniahdyiswesfsnvsyytri
    lpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqgtnlmfaffaqhfthqffk
    tsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklkyqmlngevyppsveeapv
    lmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvcdllkaehptwgdeqlfqt
    arliligetikivieeyvqqlsgyflqlkfdpellfgaqfqyrnriamefnqlyhwhplm
    pdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagrigggrnidhhilhvavdv
    ikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaeleelygdidalefypglllek
    chpnsifgesmiemgapfslkgllgnpicspeywkastfggevgfnlvktatlkklvcln
    tktcpyvsfhvpd