PDB entry 3n8u

View 3n8u on RCSB PDB site
Description: crystal structure of an imelysin peptidase (bacova_03801) from bacteroides ovatus at 1.44 a resolution
Deposited on 2010-05-28, released 2010-07-28
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: imelysin peptidase
    Species: Bacteroides ovatus [TaxId:411476]
    Gene: BACOVA_03801
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: imelysin peptidase
    Species: Bacteroides ovatus [TaxId:411476]
    Gene: BACOVA_03801
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, CL, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n8uA (A:)
    gsdddnptvdpanidytpenasswhnymrnvaallktdatnlynawnssykggesyaslf
    kahsgspyasalscveeivdkcaeianevgtakigdpynlykagnteealyaveswyswh
    srddytnniysirnayygsldgninanslstviaganssldtkiknaiqkaakaiqdipq
    pfrnhipsnetvaamdacaelesilkndlksyiannsnnintdavlnpvvtqyvdavvvp
    tykslkekndalynavivladnpsnsafetacdawitarepwekseaflfgpvdemgldp
    nmdswpldqnaivqilnsqswsdlewsegddeaavesaqnvrgfhtlefllykngeprkv
    q
    

    Sequence, based on observed residues (ATOM records):
    >3n8uA (A:)
    dpanidytpenasswhnymrnvaallktdatnlynawnssykggesyaslfkahsgspya
    salscveeivdkcaeianevgtakigdpynlykagnteealyaveswyswhsrddytnni
    ysirnayygsldgninanslstviaganssldtkiknaiqkaakaiqdipqpfrnhipsn
    etvaamdacaelesilkndlksyiannsnnintdavlnpvvtqyvdavvvptykslkekn
    dalynavivladnpsnsafetacdawitarepwekseaflfgpvdemgldpnmdswpldq
    naivqilnsqswsdlewsegddeaavesaqnvrgfhtlefllykngeprkvq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n8uB (B:)
    gsdddnptvdpanidytpenasswhnymrnvaallktdatnlynawnssykggesyaslf
    kahsgspyasalscveeivdkcaeianevgtakigdpynlykagnteealyaveswyswh
    srddytnniysirnayygsldgninanslstviaganssldtkiknaiqkaakaiqdipq
    pfrnhipsnetvaamdacaelesilkndlksyiannsnnintdavlnpvvtqyvdavvvp
    tykslkekndalynavivladnpsnsafetacdawitarepwekseaflfgpvdemgldp
    nmdswpldqnaivqilnsqswsdlewsegddeaavesaqnvrgfhtlefllykngeprkv
    q
    

    Sequence, based on observed residues (ATOM records):
    >3n8uB (B:)
    tvdpanidytpenasswhnymrnvaallktdatnlynawnssykggesyaslfkahsgsp
    yasalscveeivdkcaeianevgtakigdpynlykagnteealyaveswyswhsrddytn
    niysirnayygsldgninanslstviaganssldtkiknaiqkaakaiqdipqpfrnhip
    snetvaamdacaelesilkndlksyiannsnnintdavlnpvvtqyvdavvvptykslke
    kndalynavivladnpsnsafetacdawitarepwekseaflfgpvdemgldpnmdswpl
    dqnaivqilnsqswsdlewsegddeaavesaqnvrgfhtlefllykngeprkvq