PDB entry 3n8t

View 3n8t on RCSB PDB site
Description: Native structure of TK1436, a GH57 branching enzyme from hyperthermophilic archaeon Thermococcus kodakaraensis
Deposited on 2010-05-28, released 2010-10-27
The last revision was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.185
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase, GH57 family
    Species: Thermococcus kodakarensis [TaxId:311400]
    Gene: TK1436
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PEG, PG4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n8tA (A:)
    mkgyltfvlhthipyvrkhgkwpfgeewvfeaisetyipllmeferlrdsgvkfgivinv
    tpvlaeqltdeymkkafeeymerklkameedlksgkydekavsymlnyfrkvydywkain
    gdiigklrelqdqgyvevitsaathgylpllgrdeairaqiangvatyekhfgmkpkgiw
    lpecayrpagewelpggrkvkrqgiekfleefglryffvesrlidegpasnvygevliad
    tekttlrpywikgsnvavfarnretghqvwsahygypgdfwyrefhkkapksggqywrit
    skevglgekefydpdkamerveeharhfvslverllreheekfgekgiivapydtelfgh
    wwfegvkwlgrvlellyqrgvetptlsrfleeysgekheielpegswgansdhstwwnee
    tewtwphiyraedrmvaivsrfrgrdeltnrvieqlarellileasdwqflittgqakey
    akrrvlihsrdfhrlanelvryvkigefdvklleeleerdnpfrpvvvgpyvsenppele
    eyveppevppekeeteekpkvl
    

    Sequence, based on observed residues (ATOM records):
    >3n8tA (A:)
    mkgyltfvlhthipyvrkhgkwpfgeewvfeaisetyipllmeferlrdsgvkfgivinv
    tpvlaeqltdeymkkafeeymerklkameedlksgkydekavsymlnyfrkvydywkain
    gdiigklrelqdqgyvevitsaathgylpllgrdeairaqiangvatyekhfgmkpkgiw
    lpecayrpagewelpggrkvkrqgiekfleefglryffvesrlidegpasnvygevliad
    tekttlrpywikgsnvavfarnretghqvwsahygypgdfwyrefhkkapksggqywrit
    skevglgekefydpdkamerveeharhfvslverllreheekfgekgiivapydtelfgh
    wwfegvkwlgrvlellyqrgvetptlsrfleeysgekheielpegswgansdhstwwnee
    tewtwphiyraedrmvaivsrfrgrdeltnrvieqlarellileasdwqflittgqakey
    akrrvlihsrdfhrlanelvryvkigefdvklleeleerdnpfrpvvvgpyvsenppele
    eyveppevpp