PDB entry 3n8m

View 3n8m on RCSB PDB site
Description: Crystal Structure of the Grb2 SH2 Domain in Complex with An Acyclic Ligand Having the Sequence pYVNVP
Class: protein binding/peptide
Keywords: Grb2 SH2 domain, ligand preorganization, macrocycles, macrocyclic ligands, PROTEIN BINDING-PEPTIDE complex
Deposited on 2010-05-28, released 2010-12-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n8ma_
  • Chain 'B':
    Compound: peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3N8M (0-5)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3n8mA (A:)
iemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlr
dgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqahhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3n8mA (A:)
mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieq

  • Chain 'B':
    No sequence available.