PDB entry 3n8l

View 3n8l on RCSB PDB site
Description: crystal structure of blac-e166a covalently bound with ampicillin
Deposited on 2010-05-28, released 2011-12-14
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: blaA, blaC, MT2128, MTCY49.07c, Rv2068c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C5C1 (0-264)
      • engineered mutation (139)
  • Heterogens: PO4, AIX, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3n8lA (A:)
    dladrfaelerrydarlgvyvpatgttaaieyraderfafcstfkaplvaavlhqnplth
    ldklitytsddirsispvaqqhvqtgmtigqlcdaairysdgtaanllladlggpgggta
    aftgylrslgdtvsrldaeapelnrdppgderdtttphaialvlqqlvlgnalppdkral
    ltdwmarnttgakriragfpadwkvidktgtgdygrandiavvwsptgvpyvvavmsdra
    gggydaepreallaeaatcvagvla