PDB entry 3n8k

View 3n8k on RCSB PDB site
Description: Type II dehydroquinase from Mycobacterium tuberculosis complexed with citrazinic acid
Class: lyase
Keywords: DEHYDRATASE, SHIKIMATE PATHWAY, LYASE, AROMATIC AMINO ACID BIOSYNTHESIS, tuberculosis, drug target, citrazinic acid, Structural Genomics, TB Structural Genomics Consortium, TBSGC
Deposited on 2010-05-28, released 2010-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-08, with a file datestamp of 2011-06-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.206
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8ka_
  • Chain 'B':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8kb_
  • Chain 'C':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8kc_
  • Chain 'D':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8kd_
  • Chain 'E':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8ke_
  • Chain 'F':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8kf_
  • Chain 'G':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8kg_
  • Chain 'H':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8kh_
  • Chain 'I':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8ki_
  • Chain 'J':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8kj_
  • Chain 'K':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8kk_
  • Chain 'L':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8kl_
  • Chain 'M':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A4Z6 (25-End)
      • expression tag (19-24)
    Domains in SCOPe 2.07: d3n8km1, d3n8km2
  • Chain 'N':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8kn_
  • Chain 'O':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8ko_
  • Chain 'P':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8kp_
  • Chain 'Q':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8kq_
  • Chain 'R':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8kr_
  • Chain 'S':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8ks_
  • Chain 'T':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8kt_
  • Chain 'U':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8ku_
  • Chain 'V':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8kv_
  • Chain 'W':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8kw_
  • Chain 'X':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8kx_
  • Heterogens: D1X, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n8kA (A:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kA (A:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaehv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n8kB (B:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kB (B:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaehv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n8kC (C:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kC (C:)
    elivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldw
    ihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspia
    tgvivglgiqgyllalrylaeh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n8kD (D:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kD (D:)
    elivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldw
    ihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspia
    tgvivglgiqgyllalrylaehv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3n8kE (E:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kE (E:)
    elivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldw
    ihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspia
    tgvivglgiqgyllalrylaehv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3n8kF (F:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kF (F:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3n8kG (G:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kG (G:)
    elivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldw
    ihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspia
    tgvivglgiqgyllalrylaehv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3n8kH (H:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kH (H:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3n8kI (I:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kI (I:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3n8kJ (J:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kJ (J:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3n8kK (K:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kK (K:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3n8kL (L:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kL (L:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3n8kM (M:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kM (M:)
    lyfqshmselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsd
    seaqlldwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrr
    hsylspiatgvivglgiqgyllalrylaehv
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3n8kN (N:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kN (N:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3n8kO (O:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kO (O:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3n8kP (P:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kP (P:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3n8kQ (Q:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kQ (Q:)
    livnvingpnlgrlgrregtthdelvaliereaaelglkavvrqsdseaqlldwihqaad
    aaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivg
    lgiqgyllalrylaeh
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3n8kR (R:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kR (R:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3n8kS (S:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kS (S:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3n8kT (T:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kT (T:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3n8kU (U:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kU (U:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3n8kV (V:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kV (V:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3n8kW (W:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kW (W:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3n8kX (X:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8kX (X:)
    livnvingpnlgrlgrgtthdelvaliereaaelglkavvrqsdseaqlldwihqaadaa
    epvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivglg
    iqgyllalrylaeh