PDB entry 3n8i

View 3n8i on RCSB PDB site
Description: Crystal structure of the A isoform of human cytoplasmic protein tyrosine phosphatase (HCPTP-A) in complex with 1-naphtylacetic acid
Class: hydrolase
Keywords: tyrosine phosphatase, hydrolase, protein-ligand complex
Deposited on 2010-05-28, released 2011-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.175
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low molecular weight phosphotyrosine protein phosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: ACP1, APC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n8ia_
  • Heterogens: NLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n8iA (A:)
    aeqatksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdyrgq
    scmkrhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsyd
    pqkqliiedpyygndsdfetvyqqcvrccraflekah
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8iA (A:)
    atksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdyrgqscm
    krhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsydpqk
    qliiedpyygndsdfetvyqqcvrccraflekah