PDB entry 3n8e

View 3n8e on RCSB PDB site
Description: substrate binding domain of the human heat shock 70kda protein 9 (mortalin)
Deposited on 2010-05-28, released 2010-06-16
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.208
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stress-70 protein, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: GRP75, HSPA9, HSPA9B
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Stress-70 protein, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: GRP75, HSPA9, HSPA9B
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n8eA (A:)
    mhhhhhhssgvdlgtenlyfqsmdvtplslgietlggvftklinrnttiptkksqvfsta
    adgqtqveikvcqgeremagdnkllgqftligippaprgvpqievtfdidangivhvsak
    dkgtgreqqiviqssgglskddienmvknaekyaeedrrkkerveavnmaegiihdtetk
    me
    

    Sequence, based on observed residues (ATOM records):
    >3n8eA (A:)
    dvtplslgietlggvftklinrnttiptkksqvfstaadgqtqveikvcqgeremagdnk
    llgqftligippaprgvpqievtfdidangivhvsakdkgtgreqqiviqssgglskddi
    enmvknaekyaeedrrkkerveavnmaegiihdtetkme
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n8eB (B:)
    mhhhhhhssgvdlgtenlyfqsmdvtplslgietlggvftklinrnttiptkksqvfsta
    adgqtqveikvcqgeremagdnkllgqftligippaprgvpqievtfdidangivhvsak
    dkgtgreqqiviqssgglskddienmvknaekyaeedrrkkerveavnmaegiihdtetk
    me
    

    Sequence, based on observed residues (ATOM records):
    >3n8eB (B:)
    dvtplslgietlggvftklinrnttiptkksqvfstaadgqtqveikvcqgeremagdnk
    llgqftligippaprgvpqievtfdidangivhvsakdkgtgreqqiviqssgglskddi
    enmvknaekyaeedrrkkerveavnmaegiihdtetkme