PDB entry 3n83

View 3n83 on RCSB PDB site
Description: T244A mutant of human mitochondrial aldehyde dehydrogenase, NAD complex
Class: oxidoreductase
Keywords: oxidoreductase, ALDH, Rossmann fold
Deposited on 2010-05-27, released 2011-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH2, ALDM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05091 (Start-499)
      • engineered mutation (243)
    Domains in SCOPe 2.07: d3n83a_
  • Chain 'B':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH2, ALDM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05091 (Start-499)
      • engineered mutation (243)
    Domains in SCOPe 2.07: d3n83b_
  • Chain 'C':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH2, ALDM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05091 (Start-499)
      • engineered mutation (243)
    Domains in SCOPe 2.07: d3n83c_
  • Chain 'D':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH2, ALDM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05091 (Start-499)
      • engineered mutation (243)
    Domains in SCOPe 2.07: d3n83d_
  • Chain 'E':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH2, ALDM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05091 (Start-499)
      • engineered mutation (243)
    Domains in SCOPe 2.07: d3n83e_
  • Chain 'F':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH2, ALDM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05091 (Start-499)
      • engineered mutation (243)
    Domains in SCOPe 2.07: d3n83f_
  • Chain 'G':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH2, ALDM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05091 (Start-499)
      • engineered mutation (243)
    Domains in SCOPe 2.07: d3n83g_
  • Chain 'H':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH2, ALDM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05091 (Start-499)
      • engineered mutation (243)
    Domains in SCOPe 2.07: d3n83h_
  • Heterogens: NA, GAI, EDO, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n83A (A:)
    saaatqavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvd
    kavkaaraafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylv
    dldmvlkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklg
    palatgnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdk
    vafagsteigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgq
    cccagsrtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintg
    kqegakllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgra
    nnstyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgey
    glqaytevktvtvkvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n83A (A:)
    avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa
    raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl
    kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg
    nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvafags
    teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags
    rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak
    llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg
    laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt
    evktvtvkvpqkns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n83B (B:)
    saaatqavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvd
    kavkaaraafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylv
    dldmvlkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklg
    palatgnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdk
    vafagsteigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgq
    cccagsrtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintg
    kqegakllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgra
    nnstyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgey
    glqaytevktvtvkvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n83B (B:)
    avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa
    raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl
    kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg
    nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvafags
    teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags
    rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak
    llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg
    laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt
    evktvtvkvpqkns
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n83C (C:)
    saaatqavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvd
    kavkaaraafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylv
    dldmvlkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklg
    palatgnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdk
    vafagsteigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgq
    cccagsrtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintg
    kqegakllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgra
    nnstyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgey
    glqaytevktvtvkvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n83C (C:)
    avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa
    raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl
    kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg
    nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvafags
    teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags
    rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak
    llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg
    laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt
    evktvtvkvpqkns
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n83D (D:)
    saaatqavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvd
    kavkaaraafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylv
    dldmvlkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklg
    palatgnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdk
    vafagsteigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgq
    cccagsrtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintg
    kqegakllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgra
    nnstyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgey
    glqaytevktvtvkvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n83D (D:)
    avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa
    raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl
    kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg
    nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvafags
    teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags
    rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak
    llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg
    laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt
    evktvtvkvpqkns
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3n83E (E:)
    saaatqavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvd
    kavkaaraafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylv
    dldmvlkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklg
    palatgnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdk
    vafagsteigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgq
    cccagsrtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintg
    kqegakllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgra
    nnstyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgey
    glqaytevktvtvkvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n83E (E:)
    avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa
    raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl
    kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg
    nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvafags
    teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags
    rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak
    llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg
    laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt
    evktvtvkvpqkns
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3n83F (F:)
    saaatqavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvd
    kavkaaraafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylv
    dldmvlkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklg
    palatgnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdk
    vafagsteigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgq
    cccagsrtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintg
    kqegakllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgra
    nnstyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgey
    glqaytevktvtvkvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n83F (F:)
    avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa
    raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl
    kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg
    nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvafags
    teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags
    rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak
    llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg
    laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt
    evktvtvkvpqkns
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3n83G (G:)
    saaatqavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvd
    kavkaaraafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylv
    dldmvlkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklg
    palatgnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdk
    vafagsteigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgq
    cccagsrtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintg
    kqegakllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgra
    nnstyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgey
    glqaytevktvtvkvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n83G (G:)
    avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa
    raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl
    kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg
    nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvafags
    teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags
    rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak
    llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg
    laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt
    evktvtvkvpqkns
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3n83H (H:)
    saaatqavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvd
    kavkaaraafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylv
    dldmvlkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklg
    palatgnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdk
    vafagsteigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgq
    cccagsrtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintg
    kqegakllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgra
    nnstyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgey
    glqaytevktvtvkvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n83H (H:)
    avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa
    raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl
    kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg
    nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvafags
    teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags
    rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak
    llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg
    laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt
    evktvtvkvpqkns