PDB entry 3n80

View 3n80 on RCSB PDB site
Description: Human mitochondrial aldehyde dehydrogenase, apo form
Class: oxidoreductase
Keywords: oxidoreductase, ALDH, Rossmann fold
Deposited on 2010-05-27, released 2011-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.151
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH2, ALDM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n80a_
  • Chain 'B':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH2, ALDM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n80b_
  • Chain 'C':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH2, ALDM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n80c_
  • Chain 'D':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH2, ALDM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n80d_
  • Chain 'E':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH2, ALDM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n80e_
  • Chain 'F':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH2, ALDM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n80f_
  • Chain 'G':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH2, ALDM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n80g_
  • Chain 'H':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH2, ALDM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n80h_
  • Heterogens: GAI, EDO, NA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n80A (A:)
    saaatqavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvd
    kavkaaraafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylv
    dldmvlkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklg
    palatgnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdk
    vaftgsteigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgq
    cccagsrtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintg
    kqegakllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgra
    nnstyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgey
    glqaytevktvtvkvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n80A (A:)
    avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa
    raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl
    kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg
    nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvaftgs
    teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags
    rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak
    llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg
    laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt
    evktvtvkvpqkns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n80B (B:)
    saaatqavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvd
    kavkaaraafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylv
    dldmvlkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklg
    palatgnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdk
    vaftgsteigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgq
    cccagsrtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintg
    kqegakllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgra
    nnstyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgey
    glqaytevktvtvkvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n80B (B:)
    avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa
    raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl
    kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg
    nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvaftgs
    teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags
    rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak
    llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg
    laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt
    evktvtvkvpqkns
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n80C (C:)
    saaatqavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvd
    kavkaaraafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylv
    dldmvlkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklg
    palatgnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdk
    vaftgsteigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgq
    cccagsrtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintg
    kqegakllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgra
    nnstyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgey
    glqaytevktvtvkvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n80C (C:)
    avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa
    raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl
    kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg
    nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvaftgs
    teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags
    rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak
    llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg
    laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt
    evktvtvkvpqkns
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n80D (D:)
    saaatqavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvd
    kavkaaraafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylv
    dldmvlkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklg
    palatgnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdk
    vaftgsteigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgq
    cccagsrtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintg
    kqegakllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgra
    nnstyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgey
    glqaytevktvtvkvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n80D (D:)
    avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa
    raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl
    kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg
    nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvaftgs
    teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags
    rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak
    llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg
    laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt
    evktvtvkvpqkns
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3n80E (E:)
    saaatqavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvd
    kavkaaraafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylv
    dldmvlkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklg
    palatgnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdk
    vaftgsteigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgq
    cccagsrtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintg
    kqegakllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgra
    nnstyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgey
    glqaytevktvtvkvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n80E (E:)
    qavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavka
    araafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmv
    lkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalat
    gnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvaftg
    steigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccag
    srtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqega
    kllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannsty
    glaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqay
    tevktvtvkvpqkns
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3n80F (F:)
    saaatqavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvd
    kavkaaraafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylv
    dldmvlkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklg
    palatgnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdk
    vaftgsteigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgq
    cccagsrtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintg
    kqegakllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgra
    nnstyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgey
    glqaytevktvtvkvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n80F (F:)
    avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa
    raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl
    kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg
    nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvaftgs
    teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags
    rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak
    llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg
    laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt
    evktvtvkvpqkns
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3n80G (G:)
    saaatqavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvd
    kavkaaraafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylv
    dldmvlkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklg
    palatgnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdk
    vaftgsteigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgq
    cccagsrtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintg
    kqegakllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgra
    nnstyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgey
    glqaytevktvtvkvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n80G (G:)
    avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa
    raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl
    kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg
    nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvaftgs
    teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags
    rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak
    llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg
    laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt
    evktvtvkvpqkns
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3n80H (H:)
    saaatqavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvd
    kavkaaraafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylv
    dldmvlkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklg
    palatgnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdk
    vaftgsteigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgq
    cccagsrtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintg
    kqegakllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgra
    nnstyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgey
    glqaytevktvtvkvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n80H (H:)
    avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa
    raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl
    kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg
    nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvaftgs
    teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags
    rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak
    llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg
    laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt
    evktvtvkvpqkns